Recombinant Mouse SAMHD1 Protein (395-626 aa), His-tagged
Cat.No. : | SAMHD1-796M |
Product Overview : | Recombinant Mouse SAMHD1 Protein (395-626 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 395-626 aa |
Description : | Host restriction nuclease that blocks early-stage virus replication in dendritic and other myeloid cells. Likewise, suppresses LINE-1 retrotransposon activity. May function by reducing the cellular dNTP levels to levels too low for retroviral reverse transcription to occur. May play a role in mediating proinflammatory responses to TNF-alpha signaling. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 30.6 kDa |
AA Sequence : | DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Samhd1 SAM domain and HD domain, 1 [ Mus musculus ] |
Official Symbol | SAMHD1 |
Synonyms | SAMHD1; Mg11; E330031J07Rik; |
Gene ID | 56045 |
mRNA Refseq | NM_001139520 |
Protein Refseq | NP_001132992 |
UniProt ID | Q60710 |
◆ Recombinant Proteins | ||
SAMHD1-639C | Recombinant Cynomolgus Monkey SAMHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAMHD1-2506H | Recombinant Human SAMHD1 Protein, His-tagged | +Inquiry |
SAMHD1-2505H | Recombinant Human SAMHD1, GST-tagged | +Inquiry |
SAMHD1-796M | Recombinant Mouse SAMHD1 Protein (395-626 aa), His-tagged | +Inquiry |
SAMHD1-7452Z | Recombinant Zebrafish SAMHD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAMHD1-2072HCL | Recombinant Human SAMHD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAMHD1 Products
Required fields are marked with *
My Review for All SAMHD1 Products
Required fields are marked with *
0
Inquiry Basket