Recombinant Mouse SAP130 Protein (845-1057 aa), His-tagged
Cat.No. : | SAP130-1888M |
Product Overview : | Recombinant Mouse SAP130 Protein (845-1057 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 845-1057 aa |
Description : | Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.8 kDa |
AA Sequence : | PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Sap130 Sin3A associated protein [ Mus musculus ] |
Official Symbol | SAP130 |
Synonyms | SAP130; Sin3A associated protein; 6720406D06; 2610304F09Rik; |
Gene ID | 269003 |
mRNA Refseq | NM_172965 |
Protein Refseq | NP_766553 |
UniProt ID | Q8BIH0 |
◆ Recombinant Proteins | ||
SAP130-2508H | Recombinant Human SAP130, His-tagged | +Inquiry |
SAP130-1888M | Recombinant Mouse SAP130 Protein (845-1057 aa), His-tagged | +Inquiry |
SAP130-2509H | Recombinant Human SAP130 protein, MYC/DDK-tagged | +Inquiry |
SAP130-14666M | Recombinant Mouse SAP130 Protein | +Inquiry |
SAP130-7897M | Recombinant Mouse SAP130 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAP130 Products
Required fields are marked with *
My Review for All SAP130 Products
Required fields are marked with *
0
Inquiry Basket