Recombinant Mouse SAP130 Protein (845-1057 aa), His-tagged

Cat.No. : SAP130-1888M
Product Overview : Recombinant Mouse SAP130 Protein (845-1057 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 845-1057 aa
Description : Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.8 kDa
AA Sequence : PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Sap130 Sin3A associated protein [ Mus musculus ]
Official Symbol SAP130
Synonyms SAP130; Sin3A associated protein; 6720406D06; 2610304F09Rik;
Gene ID 269003
mRNA Refseq NM_172965
Protein Refseq NP_766553
UniProt ID Q8BIH0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAP130 Products

Required fields are marked with *

My Review for All SAP130 Products

Required fields are marked with *

0
cart-icon
0
compare icon