Recombinant Mouse SCGB3A2 Protein (22-139 aa), His-GST-tagged
Cat.No. : | SCGB3A2-2175M |
Product Overview : | Recombinant Mouse SCGB3A2 Protein (22-139 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein of Isoform C. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 22-139 aa |
Description : | Enzyme and pathway databases. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.2 kDa |
AA Sequence : | LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Scgb3a2 secretoglobin, family 3A, member 2 [ Mus musculus ] |
Official Symbol | SCGB3A2 |
Synonyms | SCGB3A2; pnSP-1; pneumo secretory protein 1; Pnsp1; UGRP1; LuLeu1; Utgrp1; |
Gene ID | 117158 |
mRNA Refseq | NM_054038 |
Protein Refseq | NP_473379 |
UniProt ID | Q920H1 |
◆ Recombinant Proteins | ||
SCGB3A2-7932M | Recombinant Mouse SCGB3A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCGB3A2-7649H | Recombinant Human SCGB3A2 | +Inquiry |
SCGB3A2-14745M | Recombinant Mouse SCGB3A2 Protein | +Inquiry |
SCGB3A2-160H | Recombinant Human SCGB3A2 Protein, HIS-tagged | +Inquiry |
SCGB3A2-1926M | Recombinant Mouse SCGB3A2 Protein (22-139 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB3A2 Products
Required fields are marked with *
My Review for All SCGB3A2 Products
Required fields are marked with *