Recombinant Mouse SCGB3A2 Protein (22-139 aa), His-GST-tagged

Cat.No. : SCGB3A2-2175M
Product Overview : Recombinant Mouse SCGB3A2 Protein (22-139 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein of Isoform C.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST&His
Protein Length : 22-139 aa
Description : Enzyme and pathway databases.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 43.2 kDa
AA Sequence : LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Scgb3a2 secretoglobin, family 3A, member 2 [ Mus musculus ]
Official Symbol SCGB3A2
Synonyms SCGB3A2; pnSP-1; pneumo secretory protein 1; Pnsp1; UGRP1; LuLeu1; Utgrp1;
Gene ID 117158
mRNA Refseq NM_054038
Protein Refseq NP_473379
UniProt ID Q920H1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCGB3A2 Products

Required fields are marked with *

My Review for All SCGB3A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon