Recombinant Mouse Sema4a protein, His-tagged
| Cat.No. : | SEMA4A-14866M |
| Product Overview : | Recombinant Mouse Sema4a(Thr33-His682) fused with His tag at C-terminal was expressed in HEK293. |
| Availability | February 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Thr33-His682 |
| Description : | Semaphorin-4A (SEMA4A) belongs to the semaphorin family which contains a Ig-like C2-type domain, a PSI domain and a Sema domain. SEMA4A is expressed from day 10 in the embryo, and low levels are found between days 10-12. SEMA4A is a cell surface receptor for PLXNB1, PLXNB2, PLXNB3 and PLXND1 that plays an important role in cell-cell signaling. It plays a role in priming antigen-specific T-cells, promotes differentiation of Th1 T-helper cells, and thereby contributes to adaptive immunity. SEMA4A promotes phosphorylation of TIMD2, inhibits angiogenesis, and promotes axon growth cone collapse, Inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| AA Sequence : | TGGQGPMPRVKYHAGDGHRALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRL KNMIPWPASERKKTECAFKKKSNETQCFNFIRVLVSYNATHLYACGTFAFSPACTFIELQDSLLL PILIDKVMDGKGQSPFDPVHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDIFLRWL HADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCKNDVGGEKLLQKKWTTFLKAQLL CAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQWQVGGTRSSAVCAFSLTDIERVFKGKYKEL NKETSRWTTYRGSEVSPRPGSCSMGPSSDKALTFMKDHFLMDEHVVGTPLLVKSGVEYTRLAVES ARGLDGSSHVVMYLGTSTGSLHKAVVPQDSSAYLVEEIQLSPDSEPVRNLQLAPAQGAVFAGFSG GIWRVPRANCSVYESCVDCVLARDPHCAWDPESRLCSLLSGSTKPWKQDMERGNPEWVCTRGPMA RSPRRQSPPQLIKEVLTVPNSILELPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGV GGLYQCVATENGYSYPVVSYWVDSQDQPLALDPELAGVPRERVQVPLTRVGGGASMAAQRSYWPH VDHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Gene Name | Sema4a sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A [ Mus musculus ] |
| Official Symbol | Sema4a |
| Synonyms | SEMA4A; sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A; semaphorin-4A; sema B; semaphorin-B; semaphorin 4A; SemB; Semab; AI132332; |
| Gene ID | 20351 |
| mRNA Refseq | NM_001163489 |
| Protein Refseq | NP_001156961 |
| UniProt ID | Q62178 |
| Chromosome Location | 3; 3 F1 |
| Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Other semaphorin interactions, organism-specific biosystem; Semaphorin interactions, organism-specific biosystem; |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| Sema4a-4001M | Active Recombinant Mouse Sema4a, HIgG1 Fc-tagged | +Inquiry |
| SEMA4A-14866M | Recombinant Mouse Sema4a protein, His-tagged | +Inquiry |
| SEMA4A-3926H | Recombinant Human SEMA4A protein, His-tagged | +Inquiry |
| SEMA4A-3925H | Recombinant Human SEMA4A protein(Met1-His683), hFc-tagged | +Inquiry |
| SEMA4A-7022H | Active Recombinant Human Sema Domain, Immunoglobulin Domain(Ig), Transmembrane Domain(TM) And Short Cytoplasmic Domain,(semaphorin) 4A, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SEMA4A-2066HCL | Recombinant Human SEMA4A cell lysate | +Inquiry |
| SEMA4A-1979HCL | Recombinant Human SEMA4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sema4a Products
Required fields are marked with *
My Review for All Sema4a Products
Required fields are marked with *
