Recombinant Mouse Serpina3n protein, His-tagged

Cat.No. : Serpina3n-531M
Product Overview : Recombinant Mouse Serpina3n protein(Q91WP6)(21-418aa), fused with N-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 21-418aa
Form : Tris-based buffer,50% glycerol
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Molecular Mass : 48.3 kDa
AA Sequence : SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK
Purity : Greater than 85% as determined by SDS-PAGE.
Official Symbol Serpina3n
Synonyms Serpina3n; serine (or cysteine) peptidase inhibitor, clade A, member 3N; Spi2-2; Spi2.2; Spi2/eb.4; serine protease inhibitor A3N; alpha-1 antiproteinase; antitrypsin; serine (or cysteine) proteinase inhibitor, clade A, member 3N; serine protease inhibitor 2-2; serpin A3N
Gene ID 20716
mRNA Refseq NM_009252
Protein Refseq NP_033278
UniProt ID Q91WP6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Serpina3n Products

Required fields are marked with *

My Review for All Serpina3n Products

Required fields are marked with *

0
cart-icon
0
compare icon