Recombinant Mouse Serpina3n protein, His-tagged
| Cat.No. : | Serpina3n-531M |
| Product Overview : | Recombinant Mouse Serpina3n protein(Q91WP6)(21-418aa), fused with N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 21-418aa |
| Form : | Tris-based buffer,50% glycerol |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Molecular Mass : | 48.3 kDa |
| AA Sequence : | SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Official Symbol | Serpina3n |
| Synonyms | Serpina3n; serine (or cysteine) peptidase inhibitor, clade A, member 3N; Spi2-2; Spi2.2; Spi2/eb.4; serine protease inhibitor A3N; alpha-1 antiproteinase; antitrypsin; serine (or cysteine) proteinase inhibitor, clade A, member 3N; serine protease inhibitor 2-2; serpin A3N |
| Gene ID | 20716 |
| mRNA Refseq | NM_009252 |
| Protein Refseq | NP_033278 |
| UniProt ID | Q91WP6 |
| ◆ Recombinant Proteins | ||
| SERPINA3N-1072M | Recombinant Mouse SERPINA3N Protein (21-418 aa), His-SUMO-tagged | +Inquiry |
| Serpina3n-530M | Recombinant Mouse Serpina3n Protein, His-tagged | +Inquiry |
| SERPINA3N-1695M | Recombinant Mouse SERPINA3N Protein (21-418 aa), His-tagged | +Inquiry |
| Serpina3n-532R | Recombinant Rat Serpina3n protein, His-tagged | +Inquiry |
| SERPINA3N-5338R | Recombinant Rat SERPINA3N Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Serpina3n Products
Required fields are marked with *
My Review for All Serpina3n Products
Required fields are marked with *
