Recombinant Mouse Sox2, His-tagged
Cat.No. : | Sox2-193M |
Product Overview : | Recombinant Mouse Transcription Factor SOX-2/SOX2-polyR is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Met319) of Mouse SOX2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Human Sex Determining Region Y Box 2 (Sox2) belongs to a diverse family of structurally-related transcription factors whose primary structure contains a high mobility group box domain. SOX2 is one of the important transcription factors required in induced pluripotent stem cells. SOX2 regulates the expression of multiple genes involved in embryonic development, including FGF-4, YES-1, ZFP206. SOX2 may as a switch in neuronal development, keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. It has been shown SOX2 can interact with PAX6. |
AA Sequence : | MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQEN PKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLP GGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQ MQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSS SHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | Sox2 SRY-box containing gene 2 [ Mus musculus ] |
Official Symbol | Sox2 |
Synonyms | SOX2; SRY-box containing gene 2; transcription factor SOX-2; lcc; ysb; Sox-2; |
Gene ID | 20674 |
mRNA Refseq | NM_011443 |
Protein Refseq | NP_035573 |
Pathway | Dopminergic Neurogenesis, organism-specific biosystem; PluriNetWork, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; |
Function | DNA binding; DNA binding; DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; chromatin binding; miRNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription factor binding; transcription regulatory region DNA binding; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
Sox2-193M | Recombinant Mouse Sox2, His-tagged | +Inquiry |
SOX2-837H | Recombinant Full Length Human SOX2 protein | +Inquiry |
SOX2-966H | Recombinant Human SOX2 | +Inquiry |
SOX2-12337Z | Recombinant Zebrafish SOX2 | +Inquiry |
SOX2-4229R | Recombinant Rhesus Macaque SOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX2-1561HCL | Recombinant Human SOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sox2 Products
Required fields are marked with *
My Review for All Sox2 Products
Required fields are marked with *
0
Inquiry Basket