Recombinant Mouse Timp4 protein, His-SUMO-tagged
Cat.No. : | Timp4-5644M |
Product Overview : | Recombinant Mouse Timp4 protein(Q9JHB3)(30-224aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 30-224aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CSCAPAHPQQHFCHSALVIRAKISSEKVVPASKDPADTQKLIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIIQP |
Gene Name | Timp4 tissue inhibitor of metalloproteinase 4 [ Mus musculus ] |
Official Symbol | Timp4 |
Synonyms | TIMP4; tissue inhibitor of metalloproteinase 4; metalloproteinase inhibitor 4; tissue inhibitor of metalloproteinases 4; TIMP-4; |
Gene ID | 110595 |
mRNA Refseq | NM_080639 |
Protein Refseq | NP_542370 |
◆ Recombinant Proteins | ||
TIMP4-3584B | Recombinant Bovine TIMP4 protein, His-tagged | +Inquiry |
TIMP4-25H | Recombinant Human TIMP4 protein, Fc-tagged | +Inquiry |
TIMP4-832B | Recombinant Mouse TIMP4 Protein (30-224 aa), His-tagged | +Inquiry |
TIMP4-3242H | Recombinant Human TIMP4, GST-tagged | +Inquiry |
Timp4-550M | Recombinant Mouse Timp4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Timp4 Products
Required fields are marked with *
My Review for All Timp4 Products
Required fields are marked with *