Recombinant Mouse Tmprss4 Protein, His/SUMO-tagged

Cat.No. : Tmprss4-3309M
Product Overview : Recombinant Mouse Tmprss4(52-435aa) fused with His/SUMO tag at the N-terminus was produced in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 52-435aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 57.8kDa
AA sequence : KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week.
Gene Name Tmprss4 transmembrane protease, serine 4 [ Mus musculus ]
Official Symbol Tmprss4
Synonyms TMPRSS4; transmembrane protease, serine 4; transmembrane protease serine 4; channel-activating protease 2; membrane-type serine protease 2; mCAP2; MGC29209;
Gene ID 214523
mRNA Refseq NM_145403
Protein Refseq NP_663378
UniProt ID Q8VCA5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tmprss4 Products

Required fields are marked with *

My Review for All Tmprss4 Products

Required fields are marked with *

0
cart-icon