Recombinant Mouse Tmprss4 Protein, His/SUMO-tagged
Cat.No. : | Tmprss4-3309M |
Product Overview : | Recombinant Mouse Tmprss4(52-435aa) fused with His/SUMO tag at the N-terminus was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 52-435aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 57.8kDa |
AA sequence : | KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week. |
Gene Name | Tmprss4 transmembrane protease, serine 4 [ Mus musculus ] |
Official Symbol | Tmprss4 |
Synonyms | TMPRSS4; transmembrane protease, serine 4; transmembrane protease serine 4; channel-activating protease 2; membrane-type serine protease 2; mCAP2; MGC29209; |
Gene ID | 214523 |
mRNA Refseq | NM_145403 |
Protein Refseq | NP_663378 |
UniProt ID | Q8VCA5 |
◆ Recombinant Proteins | ||
TMPRSS4-3308H | Recombinant Human TMPRSS4, GST-tagged | +Inquiry |
TMPRSS4-4214H | Recombinant Human TMPRSS4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMPRSS4-674H | Recombinant Human TMPRSS4 protein, His&Myc-tagged | +Inquiry |
TMPRSS4-5995HFL | Recombinant Full Length Human TMPRSS4, Flag-tagged | +Inquiry |
TMPRSS4-3839H | Recombinant Human TMPRSS4, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS4-908HCL | Recombinant Human TMPRSS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmprss4 Products
Required fields are marked with *
My Review for All Tmprss4 Products
Required fields are marked with *