Recombinant Mouse Tmprss4 Protein, His/SUMO-tagged
| Cat.No. : | Tmprss4-3309M |
| Product Overview : | Recombinant Mouse Tmprss4(52-435aa) fused with His/SUMO tag at the N-terminus was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 52-435aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 57.8kDa |
| AA sequence : | KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week. |
| Gene Name | Tmprss4 transmembrane protease, serine 4 [ Mus musculus ] |
| Official Symbol | Tmprss4 |
| Synonyms | TMPRSS4; transmembrane protease, serine 4; transmembrane protease serine 4; channel-activating protease 2; membrane-type serine protease 2; mCAP2; MGC29209; |
| Gene ID | 214523 |
| mRNA Refseq | NM_145403 |
| Protein Refseq | NP_663378 |
| UniProt ID | Q8VCA5 |
| ◆ Recombinant Proteins | ||
| Tmprss4-6527M | Recombinant Mouse Tmprss4 Protein, Myc/DDK-tagged | +Inquiry |
| Tmprss4-3309M | Recombinant Mouse Tmprss4 Protein, His/SUMO-tagged | +Inquiry |
| TMPRSS4-17121M | Recombinant Mouse TMPRSS4 Protein | +Inquiry |
| TMPRSS4-6023H | Recombinant Human TMPRSS4 Protein (Lys54-Leu437), His tagged | +Inquiry |
| TMPRSS4-4214H | Recombinant Human TMPRSS4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMPRSS4-908HCL | Recombinant Human TMPRSS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmprss4 Products
Required fields are marked with *
My Review for All Tmprss4 Products
Required fields are marked with *
