Recombinant Mouse Tnf protein

Cat.No. : Tnf-484M
Product Overview : Recombinant Mouse Tnf protein was expressed in Escherichia coli.
Availability July 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 157
Description : Tumor necrosis factor alpha (TNF-α), also called cachectin, is the best-know member of the TNF-family, which can cause cell death. This protein is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. TNF-α occurs as a secreted, soluble form and as a membrane-anchored form, both of which are biologically active. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. The biologically active native form of TNF-α is reportedly a trimer. Human and murine TNF-α show approximately 79 % homology at the amino acid level and cross-reactivity between the two species. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types.
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.2.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg in the presence of actinomycin D.
Molecular Mass : Approximately 17.4 kDa. The recombinant murine TNF-α is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.
AA Sequence : MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Endotoxin : Less than 1 EU/μg of rMuTNF-α as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Tnf
Official Symbol Tnf
Synonyms TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434;
Gene ID 21926
mRNA Refseq NM_013693
Protein Refseq NP_038721
UniProt ID P06804

Silicon nanowire biosensor for highly sensitive and multiplexed detection of oral squamous cell carcinoma biomarkers in saliva.

Journal: Analytical sciences : the international journal of the Japan Society for Analytical Chemistry    PubMed ID: 25746803    Data: 2015/11/24

Authors: Yulin Zhang, Rongmei Chen, Guo-Jun Zhang

Article Snippet:Anti-human IL-8, recombinant human IL-8, mouse antihuman TNF-α, recombinant human TNF-α were purchased from Creative BioMart.. All chemicals were purchased from Sigma-Aldrich with the exception of the amino-polyethylene glycol (amino-PEG, Fluka).All chemicals were purchased from Sigma-Aldrich with the exception of the amino-polyethylene glycol (amino-PEG, Fluka).

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnf Products

Required fields are marked with *

My Review for All Tnf Products

Required fields are marked with *

0
cart-icon