Recombinant Mouse Tnf protein
Cat.No. : | Tnf-484M |
Product Overview : | Recombinant Mouse Tnf protein was expressed in Escherichia coli. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 157 |
Description : | Tumor necrosis factor alpha (TNF-α), also called cachectin, is the best-know member of the TNF-family, which can cause cell death. This protein is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. TNF-α occurs as a secreted, soluble form and as a membrane-anchored form, both of which are biologically active. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. The biologically active native form of TNF-α is reportedly a trimer. Human and murine TNF-α show approximately 79 % homology at the amino acid level and cross-reactivity between the two species. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.2. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg in the presence of actinomycin D. |
Molecular Mass : | Approximately 17.4 kDa. The recombinant murine TNF-α is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein. |
AA Sequence : | MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Endotoxin : | Less than 1 EU/μg of rMuTNF-α as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Tnf |
Official Symbol | Tnf |
Synonyms | TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434; |
Gene ID | 21926 |
mRNA Refseq | NM_013693 |
Protein Refseq | NP_038721 |
UniProt ID | P06804 |
◆ Recombinant Proteins | ||
Tnf-538M | Recombinant Mouse Tnf protein, His-tagged | +Inquiry |
TNF-732H | Active Recombinant Human TNF Protein | +Inquiry |
Tnf-371M | Recombinant Mouse Tumor Necrosis Factor | +Inquiry |
TNF-4860R | Recombinant Rhesus monkey TNF Protein, His-tagged | +Inquiry |
Tnf-564R | Recombinant Rat Tnf protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Silicon nanowire biosensor for highly sensitive and multiplexed detection of oral squamous cell carcinoma biomarkers in saliva.
Journal: Analytical sciences : the international journal of the Japan Society for Analytical Chemistry PubMed ID: 25746803 Data: 2015/11/24
Authors: Yulin Zhang, Rongmei Chen, Guo-Jun Zhang
Article Snippet:Anti-human IL-8, recombinant human IL-8, mouse antihuman TNF-α, recombinant human TNF-α were purchased from Creative BioMart.. All chemicals were purchased from Sigma-Aldrich with the exception of the amino-polyethylene glycol (amino-PEG, Fluka).All chemicals were purchased from Sigma-Aldrich with the exception of the amino-polyethylene glycol (amino-PEG, Fluka).
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnf Products
Required fields are marked with *
My Review for All Tnf Products
Required fields are marked with *