Recombinant Mouse TNFRSF18 Protein

Cat.No. : TNFRSF18-662M
Product Overview : Recombinant Mouse TNFRSF18 protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : 250
Description : Predicted to enable tumor necrosis factor-activated receptor activity. Involved in positive regulation of cell adhesion. Located in external side of plasma membrane. Is expressed in genitourinary system; gut; heart ventricle; lung; and skin. Orthologous to human TNFRSF18 (TNF receptor superfamily member 18).
Form : Lyophilized
Molecular Mass : 15.2 kDa
AA Sequence : MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWAMRPGLPLCPKPDATRLAQLYPW
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Tnfrsf18 tumor necrosis factor receptor superfamily, member 18 [ Mus musculus (house mouse) ]
Official Symbol TNFRSF18
Synonyms TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; glucocorticoid-induced TNFR-related protein; AITR; Gitr;
Gene ID 21936
mRNA Refseq NM_009400
Protein Refseq NP_033426
UniProt ID O35714

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF18 Products

Required fields are marked with *

My Review for All TNFRSF18 Products

Required fields are marked with *

0
cart-icon