Recombinant Mouse TNFRSF18 Protein

• Cat.No.: TNFRSF18-662M
• Product Overview: Recombinant Mouse TNFRSF18 protein without tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Protein Length: 250
• Description: Predicted to enable tumor necrosis factor-activated receptor activity. Involved in positive regulation of cell adhesion. Located in external side of plasma membrane. Is expressed in genitourinary system; gut; heart ventricle; lung; and skin. Orthologous to human TNFRSF18 (TNF receptor superfamily member 18).
• Form: Lyophilized
• Molecular Mass: 15.2 kDa
• AA Sequence: MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWAMRPGLPLCPKPDATRLAQLYPW
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Tnfrsf18 tumor necrosis factor receptor superfamily, member 18 [ Mus musculus (house mouse) ]
• Official Symbol: TNFRSF18
• Synonyms: TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; glucocorticoid-induced TNFR-related protein; AITR; Gitr
• Gene ID: 21936
• mRNA Refseq: NM_009400
• Protein Refseq: NP_033426
• UniProt ID: O35714