Recombinant Mouse TNFRSF18 Protein, Fc-tagged
Cat.No. : | TNFRSF18-663M |
Product Overview : | Recombinant Mouse TNFRSF18 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 250 |
Description : | Predicted to enable tumor necrosis factor-activated receptor activity. Involved in positive regulation of cell adhesion. Located in external side of plasma membrane. Is expressed in genitourinary system; gut; heart ventricle; lung; and skin. Orthologous to human TNFRSF18 (TNF receptor superfamily member 18). |
Form : | Lyophilized |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWAMRPGLPLCPKPDATRLAQLYPW |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Tnfrsf18 tumor necrosis factor receptor superfamily, member 18 [ Mus musculus (house mouse) ] |
Official Symbol | TNFRSF18 |
Synonyms | TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; glucocorticoid-induced TNFR-related protein; AITR; Gitr; |
Gene ID | 21936 |
mRNA Refseq | NM_009400 |
Protein Refseq | NP_033426 |
UniProt ID | O35714 |
◆ Recombinant Proteins | ||
TNFRSF18-332R | Recombinant Rat TNFRSF18 protein, His-tagged | +Inquiry |
TNFRSF18-2086H | Recombinant Human TNFRSF18 protein, hFc-tagged | +Inquiry |
TNFRSF18-2091H | Active Recombinant Human TNFRSF18 protein, His-Avi-tagged, Biotinylated | +Inquiry |
TNFRSF18-554H | Recombinant Human TNFRSF18, Fc tagged | +Inquiry |
TNFRSF18-601H | Recombinant Human TNFRSF18 Protein (Gln26-Pro162), C-mFc and 6×His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF18-1143HCL | Recombinant Human TNFRSF18 cell lysate | +Inquiry |
TNFRSF18-1245RCL | Recombinant Rat TNFRSF18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF18 Products
Required fields are marked with *
My Review for All TNFRSF18 Products
Required fields are marked with *
0
Inquiry Basket