Species : |
Rat |
Source : |
HEK293 |
Tag : |
Fc |
Protein Length : |
121 |
Description : |
Predicted to enable tumor necrosis factor-activated receptor activity. Predicted to be involved in positive regulation of cell adhesion; positive regulation of leukocyte migration; and positive regulation of tyrosine phosphorylation of STAT protein. Predicted to be integral component of plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human TNFRSF18 (TNF receptor superfamily member 18). |
Form : |
Lyophilized |
Molecular Mass : |
37.2 kDa |
AA Sequence : |
MGAWAMLYGVSLICVLDLGQQSIAEEPSCGPGRVRNGTGTNTRCCSLCGPDKEDCPKGRCICVKPEYHCEDPQCKTCKHYPCQPGQRVESQGNIKFGFQCVDCAMGTFSAGREGHCRLWTK |
Purity : |
> 98% |
Applications : |
WB; ELISA; FACS; FC |
Stability : |
This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : |
At -20 centigrade. |
Concentration : |
1 mg/mL |
Storage Buffer : |
PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : |
Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |