Recombinant Rat TNFRSF18 Protein, Fc-tagged

Cat.No. : TNFRSF18-665R
Product Overview : Recombinant Rat TNFRSF18 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : Fc
Protein Length : 121
Description : Predicted to enable tumor necrosis factor-activated receptor activity. Predicted to be involved in positive regulation of cell adhesion; positive regulation of leukocyte migration; and positive regulation of tyrosine phosphorylation of STAT protein. Predicted to be integral component of plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human TNFRSF18 (TNF receptor superfamily member 18).
Form : Lyophilized
Molecular Mass : 37.2 kDa
AA Sequence : MGAWAMLYGVSLICVLDLGQQSIAEEPSCGPGRVRNGTGTNTRCCSLCGPDKEDCPKGRCICVKPEYHCEDPQCKTCKHYPCQPGQRVESQGNIKFGFQCVDCAMGTFSAGREGHCRLWTK
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Tnfrsf18 tumor necrosis factor receptor superfamily, member 18 [ Rattus norvegicus ]
Official Symbol TNFRSF18
Synonyms TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18;
Gene ID 500598
mRNA Refseq NM_001024349
Protein Refseq NP_001019520

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF18 Products

Required fields are marked with *

My Review for All TNFRSF18 Products

Required fields are marked with *

0
cart-icon