Recombinant Mouse Tnfsf10 protein

Cat.No. : Tnfsf10-1509M
Product Overview : Recombinant Mouse Tnfsf10 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 175
Description : The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 3 mM DTT.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg in the presence of actinomycin D.
Molecular Mass : Approximately 20.2 kDa, a single non-glycosylated polypeptide chain containing 175 amino acids.
AA Sequence : MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Endotoxin : Less than 0.1 EU/µg of rMuTRAIL/TNFSF10 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Tnfsf10
Official Symbol Tnfsf10
Synonyms TNFSF10; tumor necrosis factor (ligand) superfamily, member 10; tumor necrosis factor ligand superfamily member 10; TRAIL/APO2L; TNF-related apoptosis inducing ligand; TNF-related apoptosis-inducing ligand; TL2; Ly81; Trail; APO-2L; AI448571; A330042I21Rik;
Gene ID 22035
mRNA Refseq NM_009425
Protein Refseq NP_033451
UniProt ID P50592

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf10 Products

Required fields are marked with *

My Review for All Tnfsf10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon