Recombinant Mouse TSHB and TSHA Protein, His tagged
Cat.No. : | TSHB-TSHA-03M |
Product Overview : | Recombinant Mouse TSHB and TSHA Protein, (Met1-Val138, one mutant and Ala25-Ser116) with His tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Tag : | His |
Protein Length : | TSHB: Met1-Val138, one mutant TSHA: Ala25-Ser116 |
Description : | Thyroid-stimulating hormone, commonly called TSH and also referred to as thyrotropin, is a hormone that your pituitary gland releases to trigger your thyroid to produce and release its own hormones-thyroxine (T4) and triiodothyronine (T3). These two hormones are essential for maintaining your body's metabolic rate-the speed at which your body transforms the food you eat into energy and uses it. |
Molecular Mass : | ~ 27 kDa |
AA Sequence : | MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICARYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSVHHHHHH MAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSHHHHHH |
Endotoxin : | < 1 EU/μg protein by LAL |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | Supplied in PBS buffer, pH 7.4 |
Official Symbol | TSHB, TSHA |
Synonyms | TSHB; thyroid stimulating hormone subunit beta; TSH-B; TSH-BETA; thyrotropin subunit beta; thyroid stimulating hormone beta; thyrotropin beta chain; CGA; glycoprotein hormones, alpha polypeptide; HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA; glycoprotein hormones alpha chain; FSH-alpha; LSH-alpha; TSH-alpha; anterior pituitary glycoprotein hormones common subunit alpha; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha chain; follicle-stimulating hormone alpha subunit; follitropin alpha chain; luteinizing hormone alpha chain; lutropin alpha chain; thyroid-stimulating hormone alpha chain; thyrotropin alpha chain |
◆ Recombinant Proteins | ||
TSHB-TSHA-08HM | Recombinant Human TSHB [Y124D] and TSHA Heterodimer Protein, His tagged | +Inquiry |
TSHB-TSHA-06M | Recombinant Mouse TSHB and TSHA Protein, His tagged | +Inquiry |
TSHB-TSHA-07M | Recombinant Human TSHB & TSHA R55G, His-tagged | +Inquiry |
TSHB-TSHA-01M | Recombinant Mouse TSHB and TSHA Protein, C-His tagged | +Inquiry |
TSHB-TSHA-05M | Recombinant Mouse TSHB and TSHA Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSHB, TSHA Products
Required fields are marked with *
My Review for All TSHB, TSHA Products
Required fields are marked with *