Recombinant Mouse Twist1 protein, His-KSI-tagged
Cat.No. : | Twist1-6250M |
Product Overview : | Recombinant Mouse Twist1 protein(P26687)(1-206aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 1-206aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH |
Gene Name | Twist1 twist homolog 1 (Drosophila) [ Mus musculus ] |
Official Symbol | Twist1 |
Synonyms | TWIST1; twist homolog 1 (Drosophila); twist-related protein 1; Pluridigite; charlie chaplin; polydactyly EMS; Ska< sup> m10Jus< /sup> twist gene homolog 1; Pde; pdt; Ska10; Twist; M-Twist; bHLHa38; AA960487; m10Jus> MGC103391; |
Gene ID | 22160 |
mRNA Refseq | NM_011658 |
Protein Refseq | NP_035788 |
◆ Recombinant Proteins | ||
TWIST1-6521H | Recombinant Human TWIST1 Protein | +Inquiry |
Twist1-6740M | Recombinant Mouse Twist1 Protein, Myc/DDK-tagged | +Inquiry |
TWIST1-17644M | Recombinant Mouse TWIST1 Protein | +Inquiry |
TWIST1-9779M | Recombinant Mouse TWIST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TWIST1-2622H | Recombinant Human TWIST1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWIST1-1865HCL | Recombinant Human TWIST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Twist1 Products
Required fields are marked with *
My Review for All Twist1 Products
Required fields are marked with *
0
Inquiry Basket