Recombinant Mouse TXNDC12 Protein (25-170 aa), His-tagged
| Cat.No. : | TXNDC12-1870M |
| Product Overview : | Recombinant Mouse TXNDC12 Protein (25-170 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-170 aa |
| Description : | Possesses significant protein thiol-disulfide oxidase activity. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Txndc12 thioredoxin domain containing 12 (endoplasmic reticulum) [ Mus musculus ] |
| Official Symbol | TXNDC12 |
| Synonyms | TXNDC12; ER protein 19; ERp16; ERp19; 0610040B21Rik; |
| Gene ID | 66073 |
| mRNA Refseq | NM_025334 |
| Protein Refseq | NP_079610 |
| UniProt ID | Q9CQU0 |
| ◆ Recombinant Proteins | ||
| TXNDC12-1925M | Recombinant Mouse TXNDC12 Protein (25-170 aa), His-tagged | +Inquiry |
| TXNDC12-3497H | Recombinant Human TXNDC12, His-tagged | +Inquiry |
| TXNDC12-3638H | Recombinant Human TXNDC12 protein, His-SUMO-tagged | +Inquiry |
| TXNDC12-2941Z | Recombinant Zebrafish TXNDC12 | +Inquiry |
| TXNDC12-5037R | Recombinant Rhesus monkey TXNDC12 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNDC12-626HCL | Recombinant Human TXNDC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC12 Products
Required fields are marked with *
My Review for All TXNDC12 Products
Required fields are marked with *



