Recombinant Mouse Vamp7 protein, Avi-tagged, Biotinylated

• Cat.No.: Vamp7-5124M
• Product Overview: Biotinylated Recombinant Mouse Vamp7 protein(P70280)(2-220 aa), fused with Avi tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Avi
• Protein Length: 2-220 aa
• Conjugation/Label: Biotin
• Form: Tris/PBS-based buffer, 6% Trehalose.
• AASequence: AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIV YLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENK SLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARA MCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK
• Purity: >85% (SDS-PAGE)
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Vamp7 vesicle-associated membrane protein 7 [ Mus musculus ]
• Official Symbol: Vamp7
• Synonyms: VAMP7; vesicle-associated membrane protein 7; synaptobrevin like 1; synaptobrevin-like protein 1; tetanus neurotoxin-insensitive vesicle-associated membrane protein; Sybl1; VAMP-7; TI-VAMP
• Gene ID: 20955
• mRNA Refseq: NM_011515
• Protein Refseq: NP_035645