"VWF" Related Products

Expand
Expand
Expand

Recombinant Mouse VWF Protein (1498-1665 aa), His-Myc-tagged

Cat.No.: VWF-2643M
Product Overview: Recombinant Mouse VWF Protein (1498-1665 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial.
Source: Yeast
Species: Mouse
Tag : His-Myc
Form: Tris-based buffer,50% glycerol
Molecular Mass: 22.3 kDa
Protein length: 1498-1665 aa
AA Sequence: DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV
Purity: > 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name: Vwf Von Willebrand factor homolog [ Mus musculus ]
Official Symbol: VWF
Synonyms: VWF; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik;
Gene ID: 22371
mRNA Refseq: NM_011708
Protein Refseq: NP_035838
UniProt ID: Q8CIZ8

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.