Recombinant Mouse VWF Protein (1498-1665 aa), His-Myc-tagged

• Cat.No.: VWF-2643M
• Product Overview: Recombinant Mouse VWF Protein (1498-1665 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His&Myc
• Protein Length: 1498-1665 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.3 kDa
• AA Sequence: DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Vwf Von Willebrand factor homolog [ Mus musculus ]
• Official Symbol: VWF
• Synonyms: VWF; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik
• Gene ID: 22371
• mRNA Refseq: NM_011708
• Protein Refseq: NP_035838
• UniProt ID: Q8CIZ8