Recombinant Mouse VWF Protein (1498-1665 aa), His-Myc-tagged
| Cat.No. : | VWF-2643M |
| Product Overview : | Recombinant Mouse VWF Protein (1498-1665 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 1498-1665 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 22.3 kDa |
| AA Sequence : | DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Vwf Von Willebrand factor homolog [ Mus musculus ] |
| Official Symbol | VWF |
| Synonyms | VWF; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik; |
| Gene ID | 22371 |
| mRNA Refseq | NM_011708 |
| Protein Refseq | NP_035838 |
| UniProt ID | Q8CIZ8 |
| ◆ Recombinant Proteins | ||
| VWF-18421MFL | Recombinant Mouse Vwf Protein, Full Length, C-6×His tagged | +Inquiry |
| VWF-2643M | Recombinant Mouse VWF Protein (1498-1665 aa), His-Myc-tagged | +Inquiry |
| VWF-18420M | Recombinant Mouse VWF Protein, His tagged | +Inquiry |
| Vwf-7788R | Recombinant Rat Vwf protein, His-tagged | +Inquiry |
| VWF-5435HFL | Recombinant Full Length Human VWF, Flag-tagged | +Inquiry |
| ◆ Native Proteins | ||
| VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
| VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VWF-001HCL | Recombinant Human VWF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWF Products
Required fields are marked with *
My Review for All VWF Products
Required fields are marked with *
