Recombinant Mouse VWF Protein (1498-1665 aa), His-Myc-tagged

Cat.No. : VWF-2643M
Product Overview : Recombinant Mouse VWF Protein (1498-1665 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His&Myc
Protein Length : 1498-1665 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.3 kDa
AA Sequence : DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Vwf Von Willebrand factor homolog [ Mus musculus ]
Official Symbol VWF
Synonyms VWF; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik;
Gene ID 22371
mRNA Refseq NM_011708
Protein Refseq NP_035838
UniProt ID Q8CIZ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VWF Products

Required fields are marked with *

My Review for All VWF Products

Required fields are marked with *

0
cart-icon