Recombinant Mouse Vwf protein, His&Myc-tagged
Cat.No. : | Vwf-3758M |
Product Overview : | Recombinant Mouse Vwf protein(Q8CIZ8)(1498-1665aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1498-1665aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Vwf Von Willebrand factor homolog [ Mus musculus ] |
Official Symbol | Vwf |
Synonyms | VWF; Von Willebrand factor homolog; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik; |
Gene ID | 22371 |
mRNA Refseq | NM_011708 |
Protein Refseq | NP_035838 |
◆ Recombinant Proteins | ||
VWF-126H | Recombinant Human Von Willebrand Factor | +Inquiry |
VWF-2543H | Recombinant Human VWF protein(1491-1900 aa), C-His-tagged | +Inquiry |
VWF-18420M | Recombinant Mouse VWF Protein, His tagged | +Inquiry |
VWF-18421MFL | Recombinant Mouse Vwf Protein, Full Length, C-6×His tagged | +Inquiry |
VWF-2712H | Active Recombinant Human VWF protein, Met/His-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
VWF-001HCL | Recombinant Human VWF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vwf Products
Required fields are marked with *
My Review for All Vwf Products
Required fields are marked with *