Recombinant Mouse Vwf protein, His&Myc-tagged
| Cat.No. : | Vwf-3758M |
| Product Overview : | Recombinant Mouse Vwf protein(Q8CIZ8)(1498-1665aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1498-1665aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.9 kDa |
| AA Sequence : | DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Vwf Von Willebrand factor homolog [ Mus musculus ] |
| Official Symbol | Vwf |
| Synonyms | VWF; Von Willebrand factor homolog; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik; |
| Gene ID | 22371 |
| mRNA Refseq | NM_011708 |
| Protein Refseq | NP_035838 |
| ◆ Recombinant Proteins | ||
| VWF-10101M | Recombinant Mouse VWF Protein, His (Fc)-Avi-tagged | +Inquiry |
| VWF-2712H | Active Recombinant Human VWF protein, Met/His-tagged | +Inquiry |
| VWF-5435HFL | Recombinant Full Length Human VWF, Flag-tagged | +Inquiry |
| VWF-5260B | Recombinant Bovine VWF protein | +Inquiry |
| VWF-126H | Recombinant Human Von Willebrand Factor | +Inquiry |
| ◆ Native Proteins | ||
| VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
| VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VWF-001HCL | Recombinant Human VWF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vwf Products
Required fields are marked with *
My Review for All Vwf Products
Required fields are marked with *



