Recombinant Mouse VWF Protein, His tagged

Cat.No. : VWF-18420M
Product Overview : Recombinant Mouse VWF Protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Mouse
Source : HEK293
Tag : His
Description : Predicted to enable several functions, including chaperone binding activity; identical protein binding activity; and integrin binding activity. Acts upstream of or within several processes, including liver development; placenta development; and platelet activation. Located in external side of plasma membrane. Is expressed in several structures, including cardiovascular system; extraembryonic component; genitourinary system; leptomeninges; and vitelline blood vessel. Used to study von Willebrand's disease and von Willebrand's disease 2. Human ortholog(s) of this gene implicated in several diseases, including Behcet's disease; Bernard-Soulier syndrome; end stage renal disease; essential thrombocythemia; and von Willebrand's disease (multiple). Orthologous to human VWF (von Willebrand factor).
Molecular Mass : The protein has a calculated MW of 55 kDa.
AA Sequence : HHHHHHSLSCRPPMVKLVCPADNPRAQGLECAKTCQNYDLERMSLGCVSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGDTVKIGCNTCVCRERKWNCTNHVCDATRSAIGMAHYLTFDGLKYLFPGECQYVLVYDYCGSNPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKRPLRDESHFEVVESGRYVILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDSTTSSLQVEEDPVNFGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPYLDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGYECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCEVAGRRLAPGKKITLSPDDPAHCQNCHCDGVNLTCEACQEPGGLVAPPTDAPVSSTTPYVEDTP
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.018 mg/mL by BCA
Storage Buffer : Sterile PB, 500 mM NaCl, pH 7.4
Gene Name Vwf Von Willebrand factor homolog [ Mus musculus (house mouse) ]
Official Symbol Vwf
Synonyms VWF; Von Willebrand factor homolog; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik;
Gene ID 22371
mRNA Refseq NM_011708
Protein Refseq NP_035838
UniProt ID Q8CIZ8

Novel antibodies against GPIbα inhibit pulmonary metastasis by affecting vWF-GPIbα interaction

Journal: Journal of Hematology & Oncology    PubMed ID: 30223883    Data: 2018/9/17

Authors: Yingxue Qi, Wenchun Chen, Xin Liang

Article Snippet:Secondary antibody anti-human/mouse CD62P (P-selectin) APC was from Thermo Fisher scientific (17-0626, USA), and FITC-conjugated anti-human PAC-1 was from Biolegend (362803, USA).Secondary antibody anti-human/mouse CD62P (P-selectin) APC was from Thermo Fisher scientific (17-0626, USA), and FITC-conjugated anti-human PAC-1 was from Biolegend (362803, USA).. Peptides of GPIbα fragments were synthesized by GL Biochen (China) Ltd. Recombinant mouse vWF protein was from Creative BioMart (VWF-1432 M, USA), and human vWF protein was from Sino Biological (10973-H08C, USA).. C57BL/6J mice, BCLB/C mice, and Wistar rat were from JSJ laboratories (China) and were bred and housed at Putuo animal care facility.C57BL/6J mice, BCLB/C mice, and Wistar rat were from JSJ laboratories (China) and were bred and housed at Putuo animal care facility.

2B4 and 1D12 inhibit vWF binding. a The vWF binding was inhibited by 2B4 and 1D12 and detected by flow cytometry. Washed mouse platelets were incubated with 10 μg/ml 2B4 or 10 μg/ml 1D12 for 20 min, and then 2 μg/ml recombined mouse vWF was added in the presence of 1 mg/ml ristocetin. Binding of vWF was detected with FITC-conjugated mouse vWF IgG by flow cytometry and quantitated by mean fluorescence intensity. b 2B4 inhibited ristocetin- and collagen-induced platelet aggregation. Different agonist-induced aggregation of PRP that had been pretreated with 10 μg/ml rat IgG (negative control, gray), 10 μg/ml 2B4 (blue), and 10 μg/ml 1D12 (orange) were detected for 6 min. Agonists: ristocetin (1 mg/ml), thrombin (0.05 U/ml), ADP (10 nM), and collagen (2 μg/ml). The histograms are representative of three independent experiments

2B4 and 1D12 inhibit vWF binding. a The vWF binding was inhibited by 2B4 and 1D12 and detected by flow cytometry. Washed mouse platelets were incubated with 10 μg/ml 2B4 or 10 μg/ml 1D12 for 20 min, and then 2 μg/ml recombined mouse vWF was added in the presence of 1 mg/ml ristocetin. Binding of vWF was detected with FITC-conjugated mouse vWF IgG by flow cytometry and quantitated by mean fluorescence intensity. b 2B4 inhibited ristocetin- and collagen-induced platelet aggregation. Different agonist-induced aggregation of PRP that had been pretreated with 10 μg/ml rat IgG (negative control, gray), 10 μg/ml 2B4 (blue), and 10 μg/ml 1D12 (orange) were detected for 6 min. Agonists: ristocetin (1 mg/ml), thrombin (0.05 U/ml), ADP (10 nM), and collagen (2 μg/ml). The histograms are representative of three independent experiments

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VWF Products

Required fields are marked with *

My Review for All VWF Products

Required fields are marked with *

0
cart-icon