Recombinant Mouse VWF Protein, His tagged
Cat.No. : | VWF-18420M |
Product Overview : | Recombinant Mouse VWF Protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Description : | Predicted to enable several functions, including chaperone binding activity; identical protein binding activity; and integrin binding activity. Acts upstream of or within several processes, including liver development; placenta development; and platelet activation. Located in external side of plasma membrane. Is expressed in several structures, including cardiovascular system; extraembryonic component; genitourinary system; leptomeninges; and vitelline blood vessel. Used to study von Willebrand's disease and von Willebrand's disease 2. Human ortholog(s) of this gene implicated in several diseases, including Behcet's disease; Bernard-Soulier syndrome; end stage renal disease; essential thrombocythemia; and von Willebrand's disease (multiple). Orthologous to human VWF (von Willebrand factor). |
Molecular Mass : | The protein has a calculated MW of 55 kDa. |
AA Sequence : | HHHHHHSLSCRPPMVKLVCPADNPRAQGLECAKTCQNYDLERMSLGCVSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGDTVKIGCNTCVCRERKWNCTNHVCDATRSAIGMAHYLTFDGLKYLFPGECQYVLVYDYCGSNPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKRPLRDESHFEVVESGRYVILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDSTTSSLQVEEDPVNFGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPYLDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGYECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCEVAGRRLAPGKKITLSPDDPAHCQNCHCDGVNLTCEACQEPGGLVAPPTDAPVSSTTPYVEDTP |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.018 mg/mL by BCA |
Storage Buffer : | Sterile PB, 500 mM NaCl, pH 7.4 |
Gene Name | Vwf Von Willebrand factor homolog [ Mus musculus (house mouse) ] |
Official Symbol | Vwf |
Synonyms | VWF; Von Willebrand factor homolog; von Willebrand factor; VWD; F8VWF; AI551257; C630030D09; 6820430P06Rik; B130011O06Rik; |
Gene ID | 22371 |
mRNA Refseq | NM_011708 |
Protein Refseq | NP_035838 |
UniProt ID | Q8CIZ8 |
◆ Recombinant Proteins | ||
VWF-5435HFL | Recombinant Full Length Human VWF, Flag-tagged | +Inquiry |
VWF-18420M | Recombinant Mouse VWF Protein, His tagged | +Inquiry |
Vwf-1432M | Recombinant Mouse Vwf protein, His-tagged | +Inquiry |
VWF-4903P | Recombinant Pig VWF protein, His-tagged | +Inquiry |
VWF-4940D | Recombinant Dog VWF protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
VWF-001HCL | Recombinant Human VWF cell lysate | +Inquiry |
Novel antibodies against GPIbα inhibit pulmonary metastasis by affecting vWF-GPIbα interaction
Journal: Journal of Hematology & Oncology PubMed ID: 30223883 Data: 2018/9/17
Authors: Yingxue Qi, Wenchun Chen, Xin Liang
Article Snippet:Secondary antibody anti-human/mouse CD62P (P-selectin) APC was from Thermo Fisher scientific (17-0626, USA), and FITC-conjugated anti-human PAC-1 was from Biolegend (362803, USA).Secondary antibody anti-human/mouse CD62P (P-selectin) APC was from Thermo Fisher scientific (17-0626, USA), and FITC-conjugated anti-human PAC-1 was from Biolegend (362803, USA).. Peptides of GPIbα fragments were synthesized by GL Biochen (China) Ltd. Recombinant mouse vWF protein was from Creative BioMart (VWF-1432 M, USA), and human vWF protein was from Sino Biological (10973-H08C, USA).. C57BL/6J mice, BCLB/C mice, and Wistar rat were from JSJ laboratories (China) and were bred and housed at Putuo animal care facility.C57BL/6J mice, BCLB/C mice, and Wistar rat were from JSJ laboratories (China) and were bred and housed at Putuo animal care facility.

2B4 and 1D12 inhibit
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWF Products
Required fields are marked with *
My Review for All VWF Products
Required fields are marked with *