Recombinant Mouse Wif1 Protein, His-tagged
Cat.No. : | Wif1-7382M |
Product Overview : | Recombinant Mouse Wif1 protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 29-379 |
Description : | Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation. |
Form : | Liquid |
Molecular Mass : | 39.4 kDa |
AA Sequence : | GQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIWVEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | 20 mM MES (pH 5.5) containing 1 mM DTT, 1 mM PMSF, 30 % glycerol. |
Gene Name | Wif1 Wnt inhibitory factor 1 [ Mus musculus (house mouse) ] |
Official Symbol | Wif1 |
Synonyms | Wif1; Wnt inhibitory factor 1; WIF-; WIF-1; AW107799; wnt inhibitory factor 1 |
Gene ID | 24117 |
mRNA Refseq | NM_011915 |
Protein Refseq | NP_036045 |
UniProt ID | Q9WUA1 |
◆ Recombinant Proteins | ||
WIF1-2698H | Recombinant Human WIF1 protein, His-tagged | +Inquiry |
Wif1-7001M | Recombinant Mouse Wif1 Protein, Myc/DDK-tagged | +Inquiry |
Wif1-7410M | Recombinant Mouse Wif1 protein(Met1-Trp379), His-tagged | +Inquiry |
WIF1-516H | Recombinant Human WNT Inhibitory Factor 1, His-tagged | +Inquiry |
WIF1-268H | Active Recombinant Human WIF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WIF1-1525MCL | Recombinant Mouse WIF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Wif1 Products
Required fields are marked with *
My Review for All Wif1 Products
Required fields are marked with *
0
Inquiry Basket