Recombinant Mouse ZNF346 Protein (1-294 aa), His-SUMO-tagged
Cat.No. : | ZNF346-1782M |
Product Overview : | Recombinant Mouse ZNF346 Protein (1-294 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-294 aa |
Description : | Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Zfp346 zinc finger protein 346 [ Mus musculus (house mouse) ] |
Official Symbol | ZNF346 |
Synonyms | Jaz; Znf346; |
Gene ID | 26919 |
mRNA Refseq | NM_012017 |
Protein Refseq | NP_036147 |
UniProt ID | Q9R0B7 |
◆ Recombinant Proteins | ||
Zfp346-7085M | Recombinant Mouse Zfp346 Protein, Myc/DDK-tagged | +Inquiry |
ZNF346-5203Z | Recombinant Zebrafish ZNF346 | +Inquiry |
ZFP346-18897M | Recombinant Mouse ZFP346 Protein | +Inquiry |
ZNF346-2306H | Recombinant Human ZNF346, His-tagged | +Inquiry |
ZNF346-3841H | Recombinant Human ZNF346, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF346-2016HCL | Recombinant Human ZNF346 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF346 Products
Required fields are marked with *
My Review for All ZNF346 Products
Required fields are marked with *