Recombinant Mouse ZNF346 Protein (1-294 aa), His-SUMO-tagged
| Cat.No. : | ZNF346-1782M |
| Product Overview : | Recombinant Mouse ZNF346 Protein (1-294 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-294 aa |
| Description : | Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 48.7 kDa |
| AA Sequence : | MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Zfp346 zinc finger protein 346 [ Mus musculus (house mouse) ] |
| Official Symbol | ZNF346 |
| Synonyms | Jaz; Znf346; |
| Gene ID | 26919 |
| mRNA Refseq | NM_012017 |
| Protein Refseq | NP_036147 |
| UniProt ID | Q9R0B7 |
| ◆ Recombinant Proteins | ||
| ZNF346-10416M | Recombinant Mouse ZNF346 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZFP346-18897M | Recombinant Mouse ZFP346 Protein | +Inquiry |
| ZNF346-1782M | Recombinant Mouse ZNF346 Protein (1-294 aa), His-SUMO-tagged | +Inquiry |
| ZNF346-3841H | Recombinant Human ZNF346, GST-tagged | +Inquiry |
| ZNF346-5203Z | Recombinant Zebrafish ZNF346 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF346-2016HCL | Recombinant Human ZNF346 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF346 Products
Required fields are marked with *
My Review for All ZNF346 Products
Required fields are marked with *
