Recombinant N. meningitidis Major outer membrane protein P.IB Protein, His-SUMO-tagged

Cat.No. : porB-1337N
Product Overview : Recombinant N. meningitidis serogroup B Major outer membrane protein P.IB Protein (20-331aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : N.meningitidis
Source : E.coli
Tag : His&SUMO
Protein Length : 20-331 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 49.8 kDa
AA Sequence : DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Major outer membrane protein P.IB
Official Symbol Major outer membrane protein P.IB
Synonyms Major outer membrane protein P.IB; porB; Protein IB; PIB; Class 3 protein; Porin
UniProt ID E6MZM0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Major outer membrane protein P.IB Products

Required fields are marked with *

My Review for All Major outer membrane protein P.IB Products

Required fields are marked with *

0
cart-icon
0
compare icon