Recombinant Neisseria Meningitidis Serogroup B MRCA Protein (206-413 aa), His-SUMO-tagged
| Cat.No. : | MRCA-2176N |
| Product Overview : | Recombinant Neisseria Meningitidis Serogroup B (strain MC58) MRCA Protein (206-413 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Neisseria Meningitidis Serogroup B |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 206-413 aa |
| Description : | Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 40.0 kDa |
| AA Sequence : | KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Synonyms | mrcA; Peptidoglycan TGase DD-transpeptidase; |
| UniProt ID | P0A0Z6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRCA Products
Required fields are marked with *
My Review for All MRCA Products
Required fields are marked with *
