Recombinant Pig B2M protein
| Cat.No. : | B2M-464P |
| Product Overview : | Recombinant Pig B2M protein(Q07717)(21-118aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 21-118a.a. |
| Tag : | Non |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 11.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH |
| Gene Name | B2M beta-2-microglobulin [ Sus scrofa ] |
| Official Symbol | B2M |
| Synonyms | B2M; beta-2-microglobulin; lactollin; beta 2-microglobulin; |
| Gene ID | 397033 |
| mRNA Refseq | NM_213978 |
| Protein Refseq | NP_999143 |
| ◆ Recombinant Proteins | ||
| B2M-76H | Recombinant Human B2M, His-tagged | +Inquiry |
| B2M-464P | Recombinant Pig B2M protein | +Inquiry |
| B2M-011H | Recombinant Hamster beta 2 microglobulin Protein, His tagged | +Inquiry |
| B2m-785M | Recombinant Mouse B2m protein, hFc-tagged | +Inquiry |
| B2M-414H | Recombinant Human B2M Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| B2M-13H | Native Human B2M | +Inquiry |
| B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
| B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
| B2M-064HKCL | Human B2M Knockdown Cell Lysate | +Inquiry |
| B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
| B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
| B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *
