Recombinant Pig GPX5 Protein (22-219 aa), His-SUMO-Myc-tagged

Cat.No. : GPX5-2169P
Product Overview : Recombinant Pig GPX5 Protein (22-219 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 22-219 aa
Description : May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 42.6 kDa
AA Sequence : NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Sus scrofa ]
Official Symbol GPX5
Synonyms GPX5; EGLP; GPx-5; GSHPx-5;
Gene ID 396920
mRNA Refseq NM_213886
Protein Refseq NP_999051
UniProt ID O18994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX5 Products

Required fields are marked with *

My Review for All GPX5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon