Recombinant Pig GPX5 Protein, His/MYC-tagged
Cat.No. : | GPX5-1232P |
Product Overview : | Recombinant Pig GPX5 Protein (22-219aa) was expressed in yeast with N-terminal His tag and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 22-219 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFG LVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELI GSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | GPX5 glutathione peroxidase 5 [ Sus scrofa (pig) ] |
Official Symbol | GPX5 |
Synonyms | GPX5; glutathione peroxidase 5; Epididymal secretory glutathione peroxidase; EC 1.11.1.9; Epididymis-specific glutathione peroxidase-like protein; EGLP Glutathione peroxidase 5; GPx-5; GSHPx-5; EGLP |
Gene ID | 396920 |
mRNA Refseq | NM_213886.1 |
Protein Refseq | NP_999051.1 |
UniProt ID | O18994 |
◆ Recombinant Proteins | ||
GPX5-2334R | Recombinant Rat GPX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX5-2142H | Recombinant Human GPX5 Protein (1-100 aa), His-Trx-tagged | +Inquiry |
GPX5-5312H | Recombinant Human GPX5 Protein, GST-tagged | +Inquiry |
GPX5-310C | Recombinant Cynomolgus Monkey GPX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX5-1786R | Recombinant Rhesus Macaque GPX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX5 Products
Required fields are marked with *
My Review for All GPX5 Products
Required fields are marked with *
0
Inquiry Basket