"PRL" Related Products

Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged

Cat.No.: PRL-741P
Product Overview: Recombinant Pig PRL Protein (31-229 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
Description: Prolactin acts primarily on the mammary gland by promoting lactation.
Source: E. coli
Species: Pig
Tag : His-SUMO
Form: Tris-based buffer, 50% glycerol
Molecular Mass: 39.0 kDa
Protein length: 31-229 aa
AA Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name: PRL prolactin [ Sus scrofa ]
Official Symbol: PRL
Synonyms: PRL; prolactin;
Gene ID: 396965
mRNA Refseq: NM_213926
Protein Refseq: NP_999091
UniProt ID: P01238

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.