"PRL" Related Products

Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged

Cat.No. : PRL-741P
Product Overview : Recombinant Pig PRL Protein (31-229 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
Description : Prolactin acts primarily on the mammary gland by promoting lactation.
Source : E. coli
Species : Pig
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 39.0 kDa
Protein length : 31-229 aa
AA Sequence : LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : PRL prolactin [ Sus scrofa ]
Official Symbol : PRL
Synonyms : PRL; prolactin;
Gene ID : 396965
mRNA Refseq : NM_213926
Protein Refseq : NP_999091
UniProt ID : P01238

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.