Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged
Cat.No. : | PRL-741P |
Product Overview : | Recombinant Pig PRL Protein (31-229 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 31-229 aa |
Description : | Prolactin acts primarily on the mammary gland by promoting lactation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.0 kDa |
AA Sequence : | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | PRL prolactin [ Sus scrofa ] |
Official Symbol | PRL |
Synonyms | PRL; prolactin; |
Gene ID | 396965 |
mRNA Refseq | NM_213926 |
Protein Refseq | NP_999091 |
UniProt ID | P01238 |
◆ Recombinant Proteins | ||
PRL-065H | Recombinant Human PRL Protein | +Inquiry |
PRL-9618Z | Recombinant Zebrafish PRL | +Inquiry |
Prl-7818M | Recombinant Mouse Prl protein, His & GST-tagged | +Inquiry |
PRL-2715H | Recombinant Human Prolactin | +Inquiry |
PRL-261H | Recombinant Human PRL, StrepII-tagged | +Inquiry |
◆ Native Proteins | ||
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *
0
Inquiry Basket