Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged
| Cat.No. : | PRL-741P |
| Product Overview : | Recombinant Pig PRL Protein (31-229 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 31-229 aa |
| Description : | Prolactin acts primarily on the mammary gland by promoting lactation. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 39.0 kDa |
| AA Sequence : | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | PRL prolactin [ Sus scrofa ] |
| Official Symbol | PRL |
| Synonyms | PRL; prolactin; |
| Gene ID | 396965 |
| mRNA Refseq | NM_213926 |
| Protein Refseq | NP_999091 |
| UniProt ID | P01238 |
| ◆ Recombinant Proteins | ||
| PRL-298B | Recombinant Bovine Prolactin Protein, His-Tagged | +Inquiry |
| PRL-106H | Recombinant Human prolactin Protein, His&Flag tagged | +Inquiry |
| PRL-3611R | Recombinant Rhesus monkey PRL Protein, His-tagged | +Inquiry |
| PRL-0044H | Recombinant Human PRL Protein | +Inquiry |
| Prl-5130M | Active Recombinant Mouse Prolactin / Prl Protein | +Inquiry |
| ◆ Native Proteins | ||
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| PRL-8245H | Native Human Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *



