Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged

Cat.No. : PRL-741P
Product Overview : Recombinant Pig PRL Protein (31-229 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : His&SUMO
Protein Length : 31-229 aa
Description : Prolactin acts primarily on the mammary gland by promoting lactation.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 39.0 kDa
AA Sequence : LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name PRL prolactin [ Sus scrofa ]
Official Symbol PRL
Synonyms PRL; prolactin;
Gene ID 396965
mRNA Refseq NM_213926
Protein Refseq NP_999091
UniProt ID P01238

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRL Products

Required fields are marked with *

My Review for All PRL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon