Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged

• Cat.No.: PRL-741P
• Product Overview: Recombinant Pig PRL Protein (31-229 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Pig
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 31-229 aa
• Description: Prolactin acts primarily on the mammary gland by promoting lactation.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 39.0 kDa
• AA Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: PRL prolactin [ Sus scrofa ]
• Official Symbol: PRL
• Synonyms: PRL; prolactin
• Gene ID: 396965
• mRNA Refseq: NM_213926
• Protein Refseq: NP_999091
• UniProt ID: P01238