Recombinant Pig SELE Protein (23-429 aa), GST-tagged

Cat.No. : SELE-800P
Product Overview : Recombinant Pig SELE Protein (23-429 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : GST
Protein Length : 23-429 aa
Description : Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 71.3 kDa
AA Sequence : WSYSASTETMTFDDASAYCQQRYTHLVAIQNHAEIEYLNSTFNYSASYYWIGIRKINGTWTWIGTKKALTPEATNWAPGEPNNKQSNEDCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSGHGECIETINSSTCQCYPGFRGLQCEQVVECDALENPVNGVVTCPQSLPWNTTCAFECKEGFELIGPEHLQCTSSGSWDGKKPTCKAVTCDTVGHPQNGDVSCNHSSIGEFAYKSTCHFTCAEGFGLQGPAQIECTAQGQWTQQAPVCKAVKCPAVSQPKNGLVKFTHSPTGEFTYKSSCAFSCEEGFELRGSAQLACTSQGQWTQEVPSCQVVQCSSLEVPREINMSCSGEPVFGAVCTFACPEGWMLNGSVALTCGATGHWSGMLPTCEAPAESKIP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name SELE selectin E [ Sus scrofa ]
Official Symbol SELE
Synonyms SELE; selectin E; E-selectin; ELAM-1; LECAM2;
Gene ID 397508
mRNA Refseq NM_214268
Protein Refseq NP_999433
UniProt ID P98110

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SELE Products

Required fields are marked with *

My Review for All SELE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon