Recombinant Pig SELE protein
Cat.No. : | SELE-6109P |
Product Overview : | Recombinant Pig SELE protein(P98110)(23-429aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | Non |
Protein Length : | 23-429aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | WSYSASTETMTFDDASAYCQQRYTHLVAIQNHAEIEYLNSTFNYSASYYWIGIRKINGTWTWIGTKKALTPEATNWAPGEPNNKQSNEDCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSGHGECIETINSSTCQCYPGFRGLQCEQVVECDALENPVNGVVTCPQSLPWNTTCAFECKEGFELIGPEHLQCTSSGSWDGKKPTCKAVTCDTVGHPQNGDVSCNHSSIGEFAYKSTCHFTCAEGFGLQGPAQIECTAQGQWTQQAPVCKAVKCPAVSQPKNGLVKFTHSPTGEFTYKSSCAFSCEEGFELRGSAQLACTSQGQWTQEVPSCQVVQCSSLEVPREINMSCSGEPVFGAVCTFACPEGWMLNGSVALTCGATGHWSGMLPTCEAPAESKIP |
Gene Name | SELE selectin E [ Sus scrofa ] |
Official Symbol | SELE |
Synonyms | SELE; selectin E; E-selectin; ELAM-1; LECAM2; CD62 antigen-like family member E; endothelial leukocyte adhesion molecule 1; selectin E (endothelial adhesion molecule 1); leukocyte-endothelial cell adhesion molecule 2; |
Gene ID | 397508 |
mRNA Refseq | NM_214268 |
Protein Refseq | NP_999433 |
◆ Recombinant Proteins | ||
SELE-597H | Recombinant Human SELE Protein, MYC/DDK-tagged | +Inquiry |
SELE-581H | Recombinant Human SELE protein, His-Avi-tagged | +Inquiry |
Sele-1791R | Recombinant Rat Selectin E | +Inquiry |
RFL35126HF | Recombinant Full Length Human E-Selectin(Sele) Protein, His-Tagged | +Inquiry |
Sele-1972M | Active Recombinant Mouse Sele protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELE-960RCL | Recombinant Rat SELE cell lysate | +Inquiry |
SELE-2992HCL | Recombinant Human SELE cell lysate | +Inquiry |
SELE-845MCL | Recombinant Mouse SELE cell lysate | +Inquiry |
SELE-1099CCL | Recombinant Cynomolgus SELE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELE Products
Required fields are marked with *
My Review for All SELE Products
Required fields are marked with *