Recombinant Plasmodium Falciparum MSA2 Protein (109-246 aa), His-tagged

Cat.No. : MSA2-1602P
Product Overview : Recombinant Plasmodium Falciparum (isolate 3D7) MSA2 Protein (109-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Plasmodium Falciparum
Source : Yeast
Tag : His
Protein Length : 109-246 aa
Description : May play a role in the merozoite attachment to the erythrocyte.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 16.7 kDa
AA Sequence : NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms MSA2; 45 kDa merozoite surface antigen;
UniProt ID P50498

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSA2 Products

Required fields are marked with *

My Review for All MSA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon