Recombinant Plasmodium Falciparum MSA2 Protein (109-246 aa), His-tagged
Cat.No. : | MSA2-1602P |
Product Overview : | Recombinant Plasmodium Falciparum (isolate 3D7) MSA2 Protein (109-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Plasmodium Falciparum |
Source : | Yeast |
Tag : | His |
Protein Length : | 109-246 aa |
Description : | May play a role in the merozoite attachment to the erythrocyte. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.7 kDa |
AA Sequence : | NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | MSA2; 45 kDa merozoite surface antigen; |
UniProt ID | P50498 |
◆ Recombinant Proteins | ||
mSA2-36E | Recombinant E. coli mSA2 Protein, N-His/C-FLAG-tagged | +Inquiry |
MSA2-1602P | Recombinant Plasmodium Falciparum MSA2 Protein (109-246 aa), His-tagged | +Inquiry |
MSA2-928P | Recombinant Plasmodium Falciparum MSA2 Protein (109-246 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSA2 Products
Required fields are marked with *
My Review for All MSA2 Products
Required fields are marked with *