Recombinant Porcine IL8 Protein
| Cat.No. : | IL8-190P |
| Product Overview : | Recombinant Porcine IL8 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Porcine |
| Source : | E.coli |
| Description : | Interleukin 8 (IL-8 or CXCL8) is a member of the CXC cytokine family and is produced by macrophages, epithelial, smooth muscle, and endothelial cells. IL-8 binds the G protein-coupled serpentine receptors CXCR1 and CXCR2. IL-8 recruits innate immune cells, induces phagocytosis, and stimulates angiogenesis. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 9.1 kDa (78 aa) |
| AA Sequence : | ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 5 mM sodium phosphate, 20 mM sodium chloride, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | IL8 interleukin 8 [ Sus scrofa (pig) ] |
| Official Symbol | IL8 |
| Synonyms | IL8; interleukin 8; interleukin-8; IL-8; C-X-C motif chemokine 8; alveolar macrophage chemotactic factor I; alveolar macrophage-derived chemotactic factor-I; CXCL8; AMCF-I; |
| Gene ID | 396880 |
| mRNA Refseq | NM_213867 |
| Protein Refseq | NP_999032 |
| UniProt ID | P26894 |
| ◆ Recombinant Proteins | ||
| IL8-5454D | Recombinant Dog IL8 protein, His-tagged | +Inquiry |
| IL8-571D | Recombinant Canine IL8 protein | +Inquiry |
| IL8-273H | Recombinant Human IL8, StrepII-tagged | +Inquiry |
| IL8-541R | Recombinant Rhesus IL8 protein | +Inquiry |
| IL8-362H | Active Recombinant Human IL8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
| IL8-3002HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL8 Products
Required fields are marked with *
My Review for All IL8 Products
Required fields are marked with *
