Recombinant Pseudomonas aeruginosa galactophilic lectin, His tagged, Galactose Labeled

• Cat.No.: lecA-10P
• Product Overview: The PA-I galactophilic lectin (lecA) is a recombinant galactose binding protein from Pseudomonas aeruginosa. It binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. The PA-I galactophilic lectin (lecA) protein has an N-terminal 7 × His tag.

Specification

• Species: Pseudomonas aeruginosa
• Source: E.coli
• Tag: His
• Conjugation/Label: Galactose
• Description: D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity.
• Form: Liquid
• Molecular Mass: 14.2 kDa
• AA Sequence: AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
• Biotin binding Site: 0
• Purity: ≥ 95% by SDS-PAGE
• Applications: In vitro research use only
• Storage: Short Term Storage: -20 centigrade Long Term Storage: -20 centigrade Avoid freeze/thaw cycle. Aliquot upon arrival.
• Storage Buffer: 10 mM PBS buffer, 50% glycerol, pH7.2
• Concentration: 0.5-1.0 mg/mL
• Shipping: Cold packs

Gene Information

• Gene Name: lecA PA-I galactophilic lectin [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: lecA
• Synonyms: lecA; galactophilic lectin; PA-I galactophilic lectin; Product name confidence: class 1 (Function experimentally demonstrated in P. aeruginosa)
• Gene ID: 882335
• Protein Refseq: NP_251260
• UniProt ID: Q05097