Recombinant Pseudomonas aeruginosa galactophilic lectin, His tagged, Galactose Labeled
| Cat.No. : | lecA-10P |
| Product Overview : | The PA-I galactophilic lectin (lecA) is a recombinant galactose binding protein from Pseudomonas aeruginosa. It binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. The PA-I galactophilic lectin (lecA) protein has an N-terminal 7 × His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pseudomonas aeruginosa |
| Source : | E.coli |
| Tag : | His |
| Conjugation/Label : | Galactose |
| Description : | D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity. |
| Form : | Liquid |
| Molecular Mass : | 14.2 kDa |
| AA Sequence : | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| Purity : | ≥ 95% by SDS-PAGE |
| Applications : | In vitro research use only |
| Storage : | Short Term Storage: -20 centigrade Long Term Storage: -20 centigrade Avoid freeze/thaw cycle. Aliquot upon arrival. |
| Storage Buffer : | 10 mM PBS buffer, 50% glycerol, pH7.2 |
| Concentration : | 0.5-1.0 mg/mL |
| Shipping : | Cold packs |
| Gene Name | lecA PA-I galactophilic lectin [ Pseudomonas aeruginosa PAO1 ] |
| Official Symbol | lecA |
| Synonyms | lecA; galactophilic lectin; PA-I galactophilic lectin; Product name confidence: class 1 (Function experimentally demonstrated in P. aeruginosa) |
| Gene ID | 882335 |
| Protein Refseq | NP_251260 |
| UniProt ID | Q05097 |
| ◆ Recombinant Proteins | ||
| lecA-10P | Recombinant Pseudomonas aeruginosa galactophilic lectin, His tagged, Galactose Labeled | +Inquiry |
| LECA-867P | Recombinant Pseudomonas Aeruginosa LECA Protein (2-122 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All lecA Products
Required fields are marked with *
My Review for All lecA Products
Required fields are marked with *
