Recombinant Pseudomonas aeruginosa galactophilic lectin, His tagged, Galactose Labeled

Cat.No. : lecA-10P
Product Overview : The PA-I galactophilic lectin (lecA) is a recombinant galactose binding protein from Pseudomonas aeruginosa. It binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. The PA-I galactophilic lectin (lecA) protein has an N-terminal 7 × His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pseudomonas aeruginosa
Source : E.coli
Tag : His
Conjugation/Label : Galactose
Description : D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity.
Form : Liquid
Molecular Mass : 14.2 kDa
AA Sequence : AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Purity : ≥ 95% by SDS-PAGE
Applications : In vitro research use only
Storage : Short Term Storage: -20 centigrade Long Term Storage: -20 centigrade Avoid freeze/thaw cycle. Aliquot upon arrival.
Storage Buffer : 10 mM PBS buffer, 50% glycerol, pH7.2
Concentration : 0.5-1.0 mg/mL
Shipping : Cold packs
Gene Name lecA PA-I galactophilic lectin [ Pseudomonas aeruginosa PAO1 ]
Official Symbol lecA
Synonyms lecA; galactophilic lectin; PA-I galactophilic lectin; Product name confidence: class 1 (Function experimentally demonstrated in P. aeruginosa)
Gene ID 882335
Protein Refseq NP_251260
UniProt ID Q05097

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All lecA Products

Required fields are marked with *

My Review for All lecA Products

Required fields are marked with *

0
cart-icon