Recombinant Rabbit ARRB1 protein, His-tagged
Cat.No. : | ARRB1-5633R |
Product Overview : | Recombinant Rabbit ARRB1 protein(Q95223)(1-410aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-410aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MGDKGTRVFKKASPNGKLTVYLGKRGFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPKLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPHPTAETTRLFLMSDKPLHLEASLDKEIYYHGEPIIVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLMREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEDDVTGSPRLNDR |
Gene Name | ARRB1 arrestin, beta 1 [ Oryctolagus cuniculus ] |
Official Symbol | ARRB1 |
Synonyms | ARRB1; arrestin, beta 1; |
Gene ID | 100009235 |
◆ Recombinant Proteins | ||
ARRB1-11H | Recombinant Human ARRB1 Protein, N-His-tagged | +Inquiry |
ARRB1-278H | Recombinant Human ARRB1, MYC/DDK-tagged | +Inquiry |
ARRB1-7429Z | Recombinant Zebrafish ARRB1 | +Inquiry |
ARRB1-753M | Recombinant Mouse ARRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARRB1-026H | Recombinant Human ARRB1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRB1-8679HCL | Recombinant Human ARRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARRB1 Products
Required fields are marked with *
My Review for All ARRB1 Products
Required fields are marked with *
0
Inquiry Basket