Recombinant Rabbit BCMA Protein, His-tagged
Cat.No. : | TNFRSF17-02R |
Product Overview : | Recombinant Rabbit BCMA Protein, fused to His tag, was expressed in HEK293. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | HEK293 |
Tag : | His |
Form : | Supplied as a 0.2 μm filtered solution in PBS (pH 7.4) |
Molecular Mass : | The Predicted Molecular Mass is about 6 kDa. |
AA Sequence : | MSQHCFQNEYFDNLLGTCKPCHLRCKAPPVTCQRYCNASVASSVKGTNAHHHHHH |
Endotoxin : | <1EU per ug (determined by the LAL method) |
Purity : | >90% as determined by SDS-PAGE |
Storage : | Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.85 mg/ml |
Gene Name | TNFRSF17 TNF receptor superfamily member 17 [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | TNFRSF17 |
Gene ID | 100340653 |
mRNA Refseq | XM_008257736.2 |
Protein Refseq | XP_008255958.1 |
◆ Recombinant Proteins | ||
TNFRSF17-151H | Recombinant Human TNFRSF17 Protein, His-tagged | +Inquiry |
TNFRSF17-3928H | Active Recombinant Human TNFRSF17 protein, His-tagged, Site-specific APC-Labeled | +Inquiry |
TNFRSF17-1322C | Active Recombinant Cynomolgus TNFRSF17 Protein, His-tagged | +Inquiry |
TNFRSF17-03P | Recombinant Pig BCMA Protein, His-tagged | +Inquiry |
TNFRSF17-237HP | Recombinant Human TNFRSF17 protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF17 Products
Required fields are marked with *
My Review for All TNFRSF17 Products
Required fields are marked with *
0
Inquiry Basket