Recombinant Rabbit CTLA4 Protein, Fc-tagged
Cat.No. : | CTLA4-656R |
Product Overview : | Recombinant Rabbit CTLA4 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 223 |
Description : | This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. |
Form : | Lyophilized |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MARLGFQRQGTQLDLASRTWSCAALFSLLFLPVFSKALHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSDFLLWILAAISSGLFFYSFLITAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens (human) ] |
Official Symbol | CTLA4 |
Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; celiac disease 3 , CELIAC3; cytotoxic T-lymphocyte protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated serine esterase-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3; |
Gene ID | 1493 |
mRNA Refseq | NM_001037631 |
Protein Refseq | NP_001032720 |
UniProt ID | P16410 |
◆ Recombinant Proteins | ||
CTLA4-372R | Recombinant Rabbit CTLA4 protein, Fc-tagged | +Inquiry |
CTLA4-109CAF647 | Active Recombinant Cynomolgus CTLA4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CTLA4-8852CF | Active Recombinant Monkey CTLA4 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CTLA4-109C | Active Recombinant Cynomolgus/Rhesus CTLA4 protein(Met1-Asp161), His-tagged | +Inquiry |
CTLA4-1061CF | Recombinant Canine CTLA4 Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
CTLA4-36M | Active Recombinant Mouse CTLA4 Homodimer Protein, His tagged | +Inquiry |
CTLA4-35H | Active Recombinant Human CTLA4 Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *