Recombinant Rabbit TNFSF13B Protein
Cat.No. : | TNFSF13B-15R |
Product Overview : | The Rabbit BAFF recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Description : | BAFF (B-cell Activation Factor), also know as Tumor Necrosis Factor Superfamily member 13B (TNFSF13B) is a member of the tumor necrosis factor ligand (TNF) ligand family. Nineteen cytokines have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha (TNFSF2), Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL(TNFSF13), BAFF (TNFSF13B), LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18). BAFF is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | AVEGVEETVIQDCLQLIADSDTPIIRKGSYTFVPWLLSFKRGRALEEKENKIVVKETGYFFIYGQVLYTDSTFAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISRDGDGTFFGALKLL(152) |
Applications : | The Rabbit BAFF endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
Gene Name | TNFSF13B tumor necrosis factor (ligand) superfamily, member 13b [ Oryctolagus cuniculus ] |
Official Symbol | TNFSF13B |
Synonyms | TNFSF13B; tumor necrosis factor (ligand) superfamily, member 13b; tumor necrosis factor ligand superfamily member 13B; B-cell activating factor; BAFF |
Gene ID | 100101577 |
mRNA Refseq | NM_001099964 |
Protein Refseq | NP_001093434 |
UniProt ID | A4UIM6 |
◆ Recombinant Proteins | ||
TNFSF13B-137CB | Active Recombinant Cynomolgus TNFSF13B protein, His-Avi-tagged, Biotinylated | +Inquiry |
TNFSF13B-378M | Recombinant Mouse TNFSF13B protein | +Inquiry |
TNFSF13B-26301TH | Recombinant Human TNFSF13B, FLAG-tagged | +Inquiry |
TNFSF13B-0385H | Active Recombinant Human TNFSF13B protein, His-Flag-tagged | +Inquiry |
Tnfsf13b-6553M | Active Recombinant Mouse Tnfsf13b Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF13B-2025HCL | Recombinant Human TNFSF13B cell lysate | +Inquiry |
TNFSF13B-1014CCL | Recombinant Cynomolgus TNFSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF13B Products
Required fields are marked with *
My Review for All TNFSF13B Products
Required fields are marked with *
0
Inquiry Basket