Recombinant Rabbit VEGFA Protein
| Cat.No. : | VEGFA-100R |
| Product Overview : | Recombinant rabbit VEGF-A (165 aa) protein without tag was expresssed in Yeast, and does not have endotoxin, naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | Yeast |
| Protein Length : | 165 |
| Description : | Vascular endothelial growth factor (VEGF) proteins stimulate vasculogenesis and angiogenesis. They are part of the system that restores the oxygen supply to tissues when blood circulation is inadequate. The normal function of VEGF proteins is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. The VEGF family has six members, including VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and Placental Growth Factor (PGF). Activity of VEGF-A, as its name implies, has been studied mostly on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g., stimulation monocyte/macrophage migration, neurons, cancer cells, kidney epithelial cells). In vitro, VEGF-A has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF). |
| Molecular Mass : | 19.3 kDa |
| AA Sequence : | APMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR(165) |
| Applications : | The Rabbit VEGF-A endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
| Gene Name | VEGFA vascular endothelial growth factor A [ Oryctolagus cuniculus (rabbit) ] |
| Official Symbol | VEGFA vascular endothelial growth factor A [ Oryctolagus cuniculus (rabbit) ] |
| Synonyms | VEGFA; vascular endothelial growth factor A; VEGF; VEGFA165b; vascular endothelial growth factor A |
| Gene ID | 100008899 |
| mRNA Refseq | XM_017345155 |
| Protein Refseq | XP_017200644 |
| UniProt ID | G1T1L9 |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
| VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
| VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
