Recombinant Rabbit VEGFA protein, His-tagged
| Cat.No. : | VEGFA-3755R |
| Product Overview : | Recombinant Rabbit VEGFA protein(XP_002714743.1)(51-511aa), fused to N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 51-511aa |
| Form : | Tris-based buffer,50% glycerol. |
| Molecular Mass : | 51.7kDa |
| AA Sequence : | YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | VEGFA vascular endothelial growth factor A [ Oryctolagus cuniculus ] |
| Official Symbol | VEGFA |
| Synonyms | VEGFA; vascular endothelial growth factor A; VEGF |
| Gene ID | 100008899 |
| Protein Refseq | XP_002714743.1 |
| ◆ Recombinant Proteins | ||
| VEGFA-272H | Active Recombinant Human VEGFA, Biotinylated | +Inquiry |
| Vegfa-7377M | Active Recombinant Mouse Vegfa Protein, His-tagged | +Inquiry |
| VEGFA-533H | Recombinant Human VEGFA Protein | +Inquiry |
| Vegfa-475MAF555 | Recombinant Mouse Vegfa Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| VEGFA-590C | Recombinant Cattle VEGFA protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
| VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
