Recombinant Rabbit VEGFA protein, His-tagged
Cat.No. : | VEGFA-3755R |
Product Overview : | Recombinant Rabbit VEGFA protein(XP_002714743.1)(51-511aa), fused to N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Tag : | His |
Protein Length : | 51-511aa |
Form : | Tris-based buffer,50% glycerol. |
Molecular Mass : | 51.7kDa |
AA Sequence : | YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | VEGFA vascular endothelial growth factor A [ Oryctolagus cuniculus ] |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; VEGF |
Gene ID | 100008899 |
Protein Refseq | XP_002714743.1 |
◆ Recombinant Proteins | ||
VEGFA-19H | Active Recombinant Human VEGFA protein | +Inquiry |
Vegfa-164M | Recombinant Mouse vascular endothelial growth factor A Protein, Tag Free | +Inquiry |
VEGFA-5152R | Recombinant Rhesus monkey VEGFA Protein, His-tagged | +Inquiry |
VEGFA-453C | Recombinant Canine VEGFA protein | +Inquiry |
VEGFA-292H | Active Recombinant Human VEGFA Protein (Ala27-Arg191), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *