Recombinant Rainbow trout IL10 protein, His-tagged
Cat.No. : | IL10-3632R |
Product Overview : | Recombinant Rainbow trout IL10 protein(Q6L8N7)(24-184aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rainbow trout |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-184aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RRVPCSDRCCSFVEGFPVRLKELRTAFSTIRDYYEANDELETSLLDEGILHHLKSPVGCHAMDSILKFYLDTVLPTAMNNRTQNNNDFKSPIDSIGNIFHELKKEIVQCRNYFSCKKPFDINEFISSYEKMQDKGLYKAMGELDLLFNYIEEYLVSKRRKH |
◆ Recombinant Proteins | ||
Il10-840M | Recombinant Mouse Il10 protein, His & T7-tagged | +Inquiry |
Il10-2566M | Recombinant Mouse Il10 protein, His-tagged | +Inquiry |
il10-15Z | Recombinant Zebrafish il10 protein | +Inquiry |
IL10-136P | Recombinant Active Pig IL10 Protein, His-tagged(C-ter) | +Inquiry |
Il10-328M | Active Recombinant Mouse Il10, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket