Recombinant Rat Aldh2 protein, His&Myc-tagged
Cat.No. : | Aldh2-2422R |
Product Overview : | Recombinant Rat Aldh2 protein(P11884)(20-519aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 20-519aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS |
Gene Name | Aldh2 aldehyde dehydrogenase 2 family (mitochondrial) [ Rattus norvegicus ] |
Official Symbol | Aldh2 |
Synonyms | ALDH2; aldehyde dehydrogenase 2 family (mitochondrial); aldehyde dehydrogenase, mitochondrial; ALDH1; ALDH-E2; ALDH class 2; mitochondrial aldehyde dehydrogenase; aldehyde dehydrogenase 2, mitochondrial; |
Gene ID | 29539 |
mRNA Refseq | NM_032416 |
Protein Refseq | NP_115792 |
◆ Recombinant Proteins | ||
Aldh2-7157M | Recombinant Mouse Aldh2 Protein, His-tagged | +Inquiry |
ALDH2-3508HFL | Recombinant Full Length Human ALDH2 protein, Flag-tagged | +Inquiry |
ALDH2-276R | Recombinant Rat ALDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Aldh2-2422R | Recombinant Rat Aldh2 protein, His&Myc-tagged | +Inquiry |
Aldh2-83M | Recombinant Mouse Aldh2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH2-8918HCL | Recombinant Human ALDH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aldh2 Products
Required fields are marked with *
My Review for All Aldh2 Products
Required fields are marked with *