Recombinant Rat AMHR2 Protein, His tagged
Cat.No. : | AMHR2-651R |
Product Overview : | Recombinant Rat AMHR2 Protein (18-144 aa) with His tag was expressed in HEK293. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Protein Length : | 18-144 aa |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 50mM Tris, 200mM NaCl, pH7.5 |
AA Sequence : | SPNRRTCVFFEAPGVRGSTKTLGEVVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCLDSDEPGCESLHCDPVPRAHPSPSSTLFTCSCGTDFCNANYSHLPPSGNRGAPGPQEPQATPGGP |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | >80% by SDS-PAGE |
Concentration : | 0.1 mg/mL by BCA |
Official Symbol | Amhr2 |
Synonyms | Amhr2; anti-Mullerian hormone receptor type 2; C14; MRII; MISRII; anti-Muellerian hormone type-2 receptor; AMH type II receptor; MIS type II receptor; anti-Muellerian hormone type II receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; EC 2.7.11.30 |
Gene ID | 29530 |
mRNA Refseq | NM_030998 |
Protein Refseq | NP_112260 |
UniProt ID | Q62893 |
◆ Recombinant Proteins | ||
AMHR2-10H | Recombinant Human AMHR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMHR2-1598M | Recombinant Mouse AMHR2 Protein | +Inquiry |
AMHR2-7685H | Recombinant Human AMHR2 protein | +Inquiry |
Amhr2-01R | Active Recombinant Rat Amhr2 Protein, Fc-tagged | +Inquiry |
AMHR2-505M | Recombinant Mouse AMHR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
AMHR2-651R | Recombinant Rat AMHR2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMHR2-8883HCL | Recombinant Human AMHR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMHR2 Products
Required fields are marked with *
My Review for All AMHR2 Products
Required fields are marked with *