Recombinant Rat AMHR2 Protein, His tagged

• Cat.No.: AMHR2-651R
• Product Overview: Recombinant Rat AMHR2 Protein (18-144 aa) with His tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 18-144 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile 50mM Tris, 200mM NaCl, pH7.5
• AA Sequence: SPNRRTCVFFEAPGVRGSTKTLGEVVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCLDSDEPGCESLHCDPVPRAHPSPSSTLFTCSCGTDFCNANYSHLPPSGNRGAPGPQEPQATPGGP
• Endotoxin: < 1 EU/μg by LAL
• Purity: >80% by SDS-PAGE
• Concentration: 0.1 mg/mL by BCA

Gene Information

• Official Symbol: Amhr2
• Synonyms: Amhr2; anti-Mullerian hormone receptor type 2; C14; MRII; MISRII; anti-Muellerian hormone type-2 receptor; AMH type II receptor; MIS type II receptor; anti-Muellerian hormone type II receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; EC 2.7.11.30
• Gene ID: 29530
• mRNA Refseq: NM_030998
• Protein Refseq: NP_112260
• UniProt ID: Q62893