Recombinant Rat AMHR2 Protein, His tagged
| Cat.No. : | AMHR2-651R |
| Product Overview : | Recombinant Rat AMHR2 Protein (18-144 aa) with His tag was expressed in HEK293. |
| Availability | September 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 18-144 aa |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile 50mM Tris, 200mM NaCl, pH7.5 |
| AA Sequence : | SPNRRTCVFFEAPGVRGSTKTLGEVVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCLDSDEPGCESLHCDPVPRAHPSPSSTLFTCSCGTDFCNANYSHLPPSGNRGAPGPQEPQATPGGP |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | >80% by SDS-PAGE |
| Concentration : | 0.1 mg/mL by BCA |
| Official Symbol | Amhr2 |
| Synonyms | Amhr2; anti-Mullerian hormone receptor type 2; C14; MRII; MISRII; anti-Muellerian hormone type-2 receptor; AMH type II receptor; MIS type II receptor; anti-Muellerian hormone type II receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; EC 2.7.11.30 |
| Gene ID | 29530 |
| mRNA Refseq | NM_030998 |
| Protein Refseq | NP_112260 |
| UniProt ID | Q62893 |
| ◆ Recombinant Proteins | ||
| Amhr2-474M | Recombinant Mouse Amhr2 Protein, MYC/DDK-tagged | +Inquiry |
| AMHR2-521H | Recombinant Human AMHR2 protein | +Inquiry |
| AMHR2-0488H | Recombinant Human AMHR2 protein, His-tagged | +Inquiry |
| AMHR2-0487M | Recombinant Mouse AMHR2 protein, His-tagged | +Inquiry |
| AMHR2-1027HF | Recombinant Full Length Human AMHR2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMHR2-8883HCL | Recombinant Human AMHR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMHR2 Products
Required fields are marked with *
My Review for All AMHR2 Products
Required fields are marked with *
