Recombinant Rat Artn protein, His&Myc-tagged
Cat.No. : | Artn-2554R |
Product Overview : | Recombinant Rat Artn protein(Q6AYE8)(112-224aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 112-224aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.1kDa |
AA Sequence : | AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Artn artemin [ Rattus norvegicus ] |
Official Symbol | Artn |
Synonyms | ARTN; artemin; |
Gene ID | 362572 |
mRNA Refseq | NM_053397 |
Protein Refseq | NP_445849 |
◆ Recombinant Proteins | ||
ARTN-801H | Active Recombinant Human ARTN | +Inquiry |
ARTN-1085HF | Recombinant Full Length Human ARTN Protein, GST-tagged | +Inquiry |
ARTN-1691H | Recombinant Human ARTN protein, His & GST-tagged | +Inquiry |
ARTN-3567H | Recombinant Human ARTN protein, His-GST&Myc-tagged | +Inquiry |
Artn-2554R | Recombinant Rat Artn protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARTN-134HCL | Recombinant Human ARTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Artn Products
Required fields are marked with *
My Review for All Artn Products
Required fields are marked with *
0
Inquiry Basket