Recombinant Rat Atf4 protein, His&Myc-tagged
| Cat.No. : | Atf4-183R |
| Product Overview : | Recombinant Rat Atf4 protein(Q9ES19)(1-347aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-347aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Atf4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Rattus norvegicus ] |
| Official Symbol | Atf4 |
| Synonyms | ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); cyclic AMP-dependent transcription factor ATF-4; rATF-4; activating transcription factor ATF-4; cAMP-dependent transcription factor ATF-4; |
| Gene ID | 79255 |
| mRNA Refseq | NM_024403 |
| Protein Refseq | NP_077379 |
| ◆ Recombinant Proteins | ||
| ATF4-217HFL | Recombinant Full Length Human ATF4 Protein, N-His-tagged | +Inquiry |
| ATF4-3596H | Recombinant Human ATF4, His Cam-tagged | +Inquiry |
| Atf4-184R | Recombinant Rat Atf4 protein, His&Myc-tagged | +Inquiry |
| Atf4-183R | Recombinant Rat Atf4 protein, His&Myc-tagged | +Inquiry |
| Atf4-6892R | Recombinant Rat Atf4 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Atf4 Products
Required fields are marked with *
My Review for All Atf4 Products
Required fields are marked with *
