Recombinant Rat ATPIF1 Protein, His-tagged
| Cat.No. : | ATPIF1-13R |
| Product Overview : | Recombinant Rat ATPIF1 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Description : | Enables ATPase inhibitor activity. Predicted to be involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Predicted to act upstream of or within positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway and reactive oxygen species metabolic process. Located in mitochondrion. Orthologous to human ATP5IF1 (ATP synthase inhibitory factor subunit 1). |
| Form : | 50 mM Tris, 300 mM NaCl, pH 8.0 |
| Molecular Mass : | 14.4 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAGSALAVRARLGVWGMRVLQTRGFGSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTREQLAALKKHHEDEIDHHSKEIERLQKQIERHKKKIKYLKNSEH |
| Purity : | ＞90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Gene Name | Atp5if1 ATP synthase inhibitory factor subunit 1 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Atp5if1 |
| Synonyms | Atpi; IF1PA; Atpif1 |
| Gene ID | 25392 |
| mRNA Refseq | NM_012915 |
| Protein Refseq | NP_037047 |
| MIM | 614981 |
| UniProt ID | Q03344 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATPIF1 Products
Required fields are marked with *
My Review for All ATPIF1 Products
Required fields are marked with *
Recently Viewed
