Recombinant Rat ATPIF1 Protein, His-tagged

Cat.No. : ATPIF1-13R
Product Overview : Recombinant Rat ATPIF1 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Description : Enables ATPase inhibitor activity. Predicted to be involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Predicted to act upstream of or within positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway and reactive oxygen species metabolic process. Located in mitochondrion. Orthologous to human ATP5IF1 (ATP synthase inhibitory factor subunit 1).
Form : 50 mM Tris, 300 mM NaCl, pH 8.0
Molecular Mass : 14.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAGSALAVRARLGVWGMRVLQTRGFGSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTREQLAALKKHHEDEIDHHSKEIERLQKQIERHKKKIKYLKNSEH
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/ml
Gene Name Atp5if1 ATP synthase inhibitory factor subunit 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol Atp5if1
Synonyms Atpi; IF1PA; Atpif1
Gene ID 25392
mRNA Refseq NM_012915
Protein Refseq NP_037047
MIM 614981
UniProt ID Q03344

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATPIF1 Products

Required fields are marked with *

My Review for All ATPIF1 Products

Required fields are marked with *

0
cart-icon