Recombinant Rat Bcan protein, His&Myc-tagged

Cat.No. : Bcan-018R
Product Overview : Recombinant Rat Bcan protein(P55068)(658-786aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Insect Cells
Tag : His&Myc
Protein Length : 658-786aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.0 kDa
AA Sequence : DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Bcan brevican [ Rattus norvegicus ]
Official Symbol Bcan
Synonyms BCAN; brevican; brevican core protein; BEHAB; brain-enriched hyaluronan-binding protein; brevican (brain specific proteoglycan in the aggrecan family); ALPBRE;
Gene ID 25393
mRNA Refseq NM_001033665
Protein Refseq NP_001028837

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Bcan Products

Required fields are marked with *

My Review for All Bcan Products

Required fields are marked with *

0
cart-icon
0
compare icon