Recombinant Rat Bcan protein, His&Myc-tagged
| Cat.No. : | Bcan-018R |
| Product Overview : | Recombinant Rat Bcan protein(P55068)(658-786aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 658-786aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.0 kDa |
| AA Sequence : | DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Bcan brevican [ Rattus norvegicus ] |
| Official Symbol | Bcan |
| Synonyms | BCAN; brevican; brevican core protein; BEHAB; brain-enriched hyaluronan-binding protein; brevican (brain specific proteoglycan in the aggrecan family); ALPBRE; |
| Gene ID | 25393 |
| mRNA Refseq | NM_001033665 |
| Protein Refseq | NP_001028837 |
| ◆ Recombinant Proteins | ||
| BCAN-115H | Recombinant Human BCAN Protein, GST-tagged | +Inquiry |
| Bcan-018R | Recombinant Rat Bcan protein, His&Myc-tagged | +Inquiry |
| Bcan-373M | Recombinant Mouse Bcan Protein, His-tagged | +Inquiry |
| BCAN-5437Z | Recombinant Zebrafish BCAN | +Inquiry |
| BCAN-1595HF | Recombinant Full Length Human BCAN Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCAN-160HCL | Recombinant Human BCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bcan Products
Required fields are marked with *
My Review for All Bcan Products
Required fields are marked with *
