Recombinant Rat Bcan protein, His&Myc-tagged
Cat.No. : | Bcan-018R |
Product Overview : | Recombinant Rat Bcan protein(P55068)(658-786aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 658-786aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.0 kDa |
AA Sequence : | DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bcan brevican [ Rattus norvegicus ] |
Official Symbol | Bcan |
Synonyms | BCAN; brevican; brevican core protein; BEHAB; brain-enriched hyaluronan-binding protein; brevican (brain specific proteoglycan in the aggrecan family); ALPBRE; |
Gene ID | 25393 |
mRNA Refseq | NM_001033665 |
Protein Refseq | NP_001028837 |
◆ Recombinant Proteins | ||
BCAN-10161H | Recombinant Human BCAN, His-tagged | +Inquiry |
BCAN-40H | Recombinant Human BCAN, His-tagged | +Inquiry |
BCAN-0075H | Recombinant Human BCAN Protein (Asp23-Pro911), C-His-tagged | +Inquiry |
BCAN-114H | Recombinant Human BCAN Protein, GST-tagged | +Inquiry |
BCAN-300H | Active Recombinant Human BCAN, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAN-160HCL | Recombinant Human BCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bcan Products
Required fields are marked with *
My Review for All Bcan Products
Required fields are marked with *
0
Inquiry Basket