Species : |
Rat |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
98 |
Description : |
CCL24, also named MPIF-2, Eotaxin-2 and Ckβ6, is a novel CC chemokine recently identified. It is a secreted protein, encoded by CCL24 gene, and produced by activated monocytes and T lymphocytes. CCL24 signals through the CCR3 receptor and has functions of chemotactic activity for resting T-lymphocytes and eosinophils, but none for monocytes and activated lymphocytes. The plasma levels of CCL24 and the aspirin-exacerbated respiratory disease (such as asthma) morbidity rate have positive correlation. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-250 ng/ml. |
Molecular Mass : |
Approximately 10.5 kDa, a single non-glycosylated polypeptide chain consisting of an N-terminal Methionine and the mature rat Eotaxin-2. |
AA Sequence : |
MPTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV |
Endotoxin : |
Less than 1 EU/µg of rRtEotaxin-2/CCL24 as determined by LAL method. |
Purity : |
>96% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |