Recombinant Rat Cfd protein, His&Myc-tagged
Cat.No. : | Cfd-2690R |
Product Overview : | Recombinant Rat Cfd protein(P32038)(26-263aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 26-263aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.8 kDa |
AA Sequence : | ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cfd complement factor D (adipsin) [ Rattus norvegicus ] |
Official Symbol | Cfd |
Synonyms | CFD; complement factor D (adipsin); complement factor D; adipsin; properdin factor D; C3 convertase activator; endogenous vascular elastase; D component of complement (adipsin); Df; Adn; EVE; |
Gene ID | 54249 |
mRNA Refseq | NM_001077642 |
Protein Refseq | NP_001071110 |
◆ Recombinant Proteins | ||
CFD-3028R | Recombinant Rhesus macaque CFD protein, Fc-tagged | +Inquiry |
CFD-1858H | Recombinant Human CFD protein, His & GST-tagged | +Inquiry |
CFD-187H | Recombinant Human CFD protein, His-tagged | +Inquiry |
Cfd-4040M | Recombinant Mouse Cfd protein, His-tagged | +Inquiry |
CFD-3208H | Recombinant Human CFD Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CFD-348H | Active Native Human Factor D | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFD-1870MCL | Recombinant Mouse CFD cell lysate | +Inquiry |
CFD-1864HCL | Recombinant Human CFD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cfd Products
Required fields are marked with *
My Review for All Cfd Products
Required fields are marked with *