Recombinant Rat CNR1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | CNR1-1094R |
| Product Overview : | Recombinant Rat CNR1 protein(P20272)(1-473aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-473aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 58.9 kDa |
| AA Sequence : | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Cnr1 cannabinoid receptor 1 (brain) [ Rattus norvegicus ] |
| Official Symbol | CNR1 |
| Synonyms | CNR1; cannabinoid receptor 1 (brain); cannabinoid receptor 1; CB1; CB-R; brain-type cannabinoid receptor; SKR6R; |
| Gene ID | 25248 |
| mRNA Refseq | NM_012784 |
| Protein Refseq | NP_036916 |
| ◆ Recombinant Proteins | ||
| CNR1-947R | Recombinant Rhesus monkey CNR1 Protein, His-tagged | +Inquiry |
| RFL32060FF | Recombinant Full Length Cat Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged | +Inquiry |
| CNR1-1498R | Recombinant Rat Cnr1 Protein | +Inquiry |
| CNR1-1153HFL | Recombinant Human CNR1 protein, His&Flag-tagged | +Inquiry |
| CNR1-27264TH | Recombinant Human CNR1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNR1-7395HCL | Recombinant Human CNR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNR1 Products
Required fields are marked with *
My Review for All CNR1 Products
Required fields are marked with *
