Recombinant Rat Commd5 protein, His&Myc-tagged
Cat.No. : | Commd5-382R |
Product Overview : | Recombinant Rat Commd5 protein(2-224aa)(Q9ERR2), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 2-224aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.2 kDa |
AA Sequence : | SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
COMMD5-1843C | Recombinant Chicken COMMD5 | +Inquiry |
COMMD5-3765M | Recombinant Mouse COMMD5 Protein | +Inquiry |
COMMD5-0386H | Recombinant Human COMMD5 protein, His&Myc-tagged | +Inquiry |
Commd5-4878R | Recombinant Rat Commd5 protein, His&Myc-tagged | +Inquiry |
COMMD5-343H | Recombinant Human COMMD5 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD5-7369HCL | Recombinant Human COMMD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Commd5 Products
Required fields are marked with *
My Review for All Commd5 Products
Required fields are marked with *
0
Inquiry Basket